KEGG   Phytophthora infestans: PITG_20385Help
Entry
PITG_20385        CDS       T01333                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase, putative
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PITG_20385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 182 aa AA seqDB search
MESPSAICLWECHYVYRAYVYPFLIRTSKDKRIPVTVVLSGDFYNMINAYINARYLSQFG
DYSGDDPFVRPSFYAGVALFVFGLSMNIHSDLVLINLRKPGDSAYKIPYGGLFKYVSSPN
YFSELLEWMGWTLLSQSPAGLSFAVYTAANLVPRALSNHLWYQEKFRGEYPTKRKAFLPF
LW
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggagagcccgtcggccatttgtctgtgggaatgtcattacgtgtaccgtgcctacgtt
tacccgtttctgattcgtacaagcaaggataaacgaatcccggtgaccgtcgtgctctct
ggggatttctacaacatgatcaatgcttacatcaatgctcggtacttaagtcagttcggc
gactacagcggggacgacccgtttgtacgcccatcattctacgcgggggtcgctctcttc
gtgttcggtctatcgatgaacattcactccgatctagtactaatcaaccttcgcaaaccc
ggggacagcgcctataagatcccatatggcggcttgttcaagtacgtgtcgtcgcccaac
tactttagtgagctactggaatggatgggctggaccctgctgtcccagtcacccgcgggt
ctgtcgttcgcggtgtacaccgccgcaaaccttgttcctcgcgccctcagcaaccacctt
tggtatcaagagaagtttcgtggggaatacccgaccaagcgaaaagctttcttgccattt
ttgtggtga

DBGET integrated database retrieval system