KEGG   Phytophthora infestans: PITG_20560Help
Entry
PITG_20560        CDS       T01333                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PITG_20560
Peptidases [BR:pif01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PITG_20560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 239 aa AA seqDB search
MSDDGKHKRWFPLESNPEVMNSYVEKMGFPTSQFSFCDVLSTEEWALAMVPTPVVGVIML
FPIKPHTEEADKQEAVRIEKDGQTVSPNVYYMRQTVGNACGTVGILHAIGNMRHLVQLTP
GSYLDKFFNKTKTKSPDEIAQFLEEDDELEETHGSAAEAGQSEQLESVDDPINTHFVCFS
CVDGNLYELDGRKKRPINHGPSSPDTVLQDACQVIKKFMARDEGEVRFTILALAKTASE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacggcaagcacaagcgctggttcccactcgagtccaatccggaggttatg
aactcatacgtggagaagatgggcttccctacgtctcaattcagcttctgcgacgtgcta
agcaccgaagagtgggcgctggctatggtgccgacccccgtggtgggggtcatcatgctt
tttccgatcaagccacacaccgaggaggctgacaagcaggaggcagtcaggatcgagaag
gacggacaaacagtgtctcccaacgtctactacatgcggcagaccgttggcaacgcttgt
ggcacggtgggaattctgcatgccatcggcaacatgcgtcacctggtgcaactaactcct
gggagttacttggacaagtttttcaacaagacgaagacaaagtcacccgatgagatcgcc
cagttccttgaggaagacgacgagctggaggaaactcacggcagcgcggcggaggctggg
cagtcggagcaactggagagcgtggacgaccccatcaacacacactttgtctgcttcagc
tgcgtggatggcaatctgtatgagctcgacgggcggaagaagcgtccaatcaaccacgga
ccgtcaagcccggacactgtgctacaggacgcctgccaagtcatcaagaagtttatggcc
cgggatgaaggcgaggtgcgtttcaccatcctggcactggcgaagacggcctctgaatga

DBGET integrated database retrieval system