KEGG   Phytophthora infestans: PITG_21378Help
Entry
PITG_21378        CDS       T01333                                 

Definition
protein disulfide-isomerase, putative
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pif  Phytophthora infestans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pif00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PITG_21378
Enzymes [BR:pif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PITG_21378
Exosome [BR:pif04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PITG_21378
  Exosomal proteins of colorectal cancer cells
   PITG_21378
  Exosomal proteins of bladder cancer cells
   PITG_21378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MMFMKQATRALTLLFAVSMVVRAAEFEQDDDVLVLTESNFAEAVSGHDTLLVEFYAPWCG
HCQKLAPEYSVAAKSLKELDPPIRLAKVDATAESKLAEQFAIRGFPTLKFFKGDVEAVKD
YDGGRTSAEIEKWVVKKSGPAVKIVGTAEELEEIKKANDVVVFAVIDAEEGETRTMLEKL
ADADDLAVYVASTSADVTQDAAAVNKVVLYKKFDEGKVVYDGEFEKESLGEFVKANSLPL
VITFSQEKAPMIFGGETTEHVLAFVDTSKDYVSDVEAALKTPAKANKGKLLHVIMPSTEK
RIVDYFGLKDEEMPAVMLVNMAGSMKKYGFDYKADDFVAKIKVGLSDDLVAFEKSYFDGK
LTPQLKSADPEDDSDEAVKVIVGTEFQKRVIDNEKDVLLEFYAPWCGHCKALAPKYEELA
EKFADVGSIMIAKMDATANEIDHPGVDVRGFPTILFFPAKDKQNPVVYEGSRDVEGFTEF
LKSNAQKFELDGTEHGAEQEEDEEGEEQELGQKEHEEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcatgaagcaagcaacgcgtgcgctgactctgctgttcgccgtgtcgatggtg
gtgcgtgcggctgagtttgagcaggatgacgacgtgttggtgctgacggagagcaacttt
gccgaggctgtctcgggacacgacacgctgctggttgaattctacgccccctggtgcggc
cactgccagaagctggcgcccgagtactcggtggctgctaagagcctcaaggagctggac
ccgcctatccgtctcgccaaggtggacgctacagccgagagcaagttggccgagcagttt
gctatccgcggcttccccacgctcaagttcttcaagggtgatgttgaggctgtcaaggac
tacgatggtggccgtacgtccgctgagatcgagaagtgggttgtcaagaagtcgggcccg
gctgtcaagatcgtggggactgctgaggagctcgaagagatcaagaaagccaacgacgtg
gtcgtgtttgccgtgatcgacgccgaggagggcgagactcgcactatgcttgaaaagctc
gcggacgccgacgatctggccgtgtacgtggcgtccaccagcgctgacgtgacgcaggat
gccgctgccgtaaacaaggtggtgctgtacaagaagttcgacgagggcaaggtcgtgtac
gacggtgaattcgagaaagagtcgctgggcgagttcgtcaaggcaaacagcctaccactc
gtcatcacgttctcgcaggagaaggcccctatgatcttcggtggcgagacgaccgagcac
gtgctggccttcgtggacacgagcaaggactacgtgtccgacgtcgaggctgctctgaag
actccggccaaggccaacaagggcaagctgctgcacgttatcatgcccagcacggagaag
cgcatcgtggactactttggtctgaaggacgaggagatgcctgccgttatgcttgtaaac
atggctggctccatgaagaagtatggttttgactacaaggctgacgactttgtcgctaag
atcaaggtcggtctcagtgacgacttggttgcattcgagaagagctactttgatggcaag
ctgacgcctcagctcaagtctgccgaccctgaggacgacagcgacgaggctgttaaggtc
attgtgggcacggagttccagaagcgtgttatcgacaacgagaaggacgtgctgctcgag
ttttacgctccgtggtgcggccactgcaaggctctcgcccctaagtacgaggaattggcc
gagaagttcgctgacgtgggcagcatcatgattgccaagatggatgccacggccaacgaa
atcgaccaccccggtgtggatgtgcgcggcttcccgacgatcctgttctttcccgcgaag
gacaagcaaaacccggtcgtgtacgagggctcgcgcgacgtggaaggcttcacggagttc
ctgaagtccaatgctcagaagttcgagcttgacggcacggagcacggcgcggagcaggaa
gaagacgaggagggggaggagcaggagctggggcagaaggagcacgaggagctgtag

DBGET integrated database retrieval system