KEGG   Psychromonas ingrahamii: Ping_0173Help
Entry
Ping_0173         CDS       T00450                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pin  Psychromonas ingrahamii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
221555..222049
Genome map
AA seq 164 aa AA seqDB search
MAAVFIGVGSSINRSENIRLGIAALQAEFGELLLSPLYESEAVGFSGVNFYNLVVKLHTE
QNIVELIKKLKGIEKQHGRPEKSSKFTPRTLDLDLLLYDQQIDPDIDLPRGEILKNAFVL
KPLSELAPTLRHPVLGETYQALWRNYPQQKQKLWKVSKQLPDHY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtttttattggcgtcggctccagtatcaaccgatctgagaatattcgttta
ggtattgcggcattacaagctgagtttggtgagttactgctttctcctctttacgaaagt
gaagctgttggtttttcaggggttaatttttacaatttagtggttaaattgcatactgag
caaaatattgtcgaattaattaaaaaacttaaaggcatagagaagcagcatggccgcccg
gaaaagtcatctaagtttaccccaagaaccttagatttagatttacttttatacgaccag
cagatagatcctgatattgatttaccgcgcggcgaaattttaaaaaatgcatttgtatta
aaacccttatccgagttagcaccaacattaagacaccctgttctgggtgaaacctatcaa
gccttgtggcggaattatccgcaacaaaagcaaaaattgtggaaagtatcaaaacagctt
cccgatcattattga

DBGET integrated database retrieval system