KEGG   Psychromonas ingrahamii: Ping_0303Help
Entry
Ping_0303         CDS       T00450                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pin  Psychromonas ingrahamii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_0303
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_0303
   00630 Glyoxylate and dicarboxylate metabolism
    Ping_0303
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ping_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
397705..399873
Genome map
AA seq 722 aa AA seqDB search
MNLPQQKQSEIESGFYNFINQEVLPHTNLNADDFWFDLMKLVNDFSPLNSQLLATRKTMQ
KQIDDWHRSHQNFDQQDYLKFLEEIGYLVEQGESFNIETENVDSEISTLAGPQLVVPVQN
ARFALNAANARWGSLYDAYYGTDLIQKTGALKPGSDFNVARGQRVITLAKDFLDEVFPLD
SGSHHDVLSYLVYYQHLLAFFPDGSKTGLKTPAQFIALDGSKSDPSYLLLKNNGLHIGIV
IDRHGKIGCSDLSGIDDIQVESALTTIIDFEDSISAVDAEDKVEAYKNWLGLIKGDLSAN
FSKDGEQMTRQLNQDKAFIDKDGEKYVVHGRALLLVRNVGHLMGSDLIQDSEGNNAPEGI
IDAAITALIGSIDLQEKTNNNIRNSRSGSIYIVKPKMHGPDEVAFTCDLFSRVEEMLKLQ
PNTIKLGIMDEERRTSANLKECIRVAKSRVVFINTGFLDRTGDEIHTSKEAGAVYPKALI
KTLPWFDAYENNNVDVGLACGFSGKAQIGKGMWAMPDEMKKMMKEKIQHPLSGANTAWVP
SPTAAILHALHYHQVDVFKEQLKIAKRPAAKQTDLLTLPIMPSDYPLSLEEIEKELENNI
QGILGYVVRWVEMGIGCSKVPDINNVGLMEDRATLRISSQHIANWLKHNICSTEQVNRIM
RNMAEIVDKQNAGVSGYQNMSPNYETNYAFQAAEALIFEGEDQPNGYTEPLLHEYRMFAK
IS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccacaacaaaaacagagtgaaattgagtcaggtttttacaatttcatcaat
caagaagtactgccacatacaaatttgaatgctgatgatttctggtttgacttaatgaaa
ttggtcaacgatttttcaccacttaattcgcagttattagccacgcgtaaaacaatgcag
aagcagattgatgattggcatcggtcgcatcagaactttgatcaacaggactacctgaaa
tttttagaagaaatcggttatttagttgagcagggcgagtcctttaatatcgaaacagag
aatgtggacagtgaaatatccacattagcaggaccgcaactggttgtaccggtacaaaat
gcacgctttgcattaaatgctgccaatgccagatggggcagtttatacgatgcctattac
ggcactgatcttatccagaaaaccggcgcgttaaaacccggttctgactttaatgtagcc
cgcggccaacgtgtgattaccttagctaaagactttcttgatgaggtgttcccgctggat
agcggctcgcaccatgatgttttaagctatttagtttattaccagcatcttctggctttt
ttcccggatggcagtaaaaccggcttaaaaacccccgctcagtttattgcattggatggt
tcgaaaagcgatccgagttatcttctgctgaaaaacaatggcttacatattggcattgtg
attgatcgccacggtaaaattggctgttcagatctttccggcattgatgatattcaagtt
gaatctgctttgacgactatcatagattttgaagactcgatttctgctgtggatgctgag
gataaagttgaagcctacaaaaactggctgggtttaatcaaaggtgatttaagcgcaaat
ttcagcaaagacggcgagcagatgacacggcagcttaatcaggacaaagccttcatcgac
aaagacggtgagaaatatgttgttcacggacgagccttgctactagtgcgtaatgttggt
cacttaatgggcagcgatttaatccaggacagtgagggcaacaatgctcccgaaggtatt
attgatgctgcgattaccgcgttaatcggcagtatcgatttacaggaaaaaacgaataat
aatatccgcaatagtcgtagcggcagcatctatattgttaaacctaaaatgcatgggccg
gacgaagtcgctttcacctgtgacttgttcagccgcgtggaagagatgcttaaactgcag
cctaataccattaaactgggcattatggatgaagaacgccgtacatcggcaaatctcaaa
gagtgtattcgggtagcaaaatcacgggtggtctttattaataccggtttcttagacaga
accggtgatgaaatccataccagtaaagaagcgggtgctgtttatcctaaagcgctgatc
aaaaccctgccctggtttgatgcttacgaaaataacaatgtagatgttggactcgcctgt
ggattctctggaaaagcgcagattggtaaaggcatgtgggcaatgcccgatgaaatgaaa
aaaatgatgaaggaaaaaattcaacatcctttatcgggtgccaataccgcttgggtaccg
tcgcctaccgccgcgatattacatgctttacattatcaccaggtggatgtttttaaagaa
cagctgaaaatagcgaagcgcccggctgccaagcagacggatttgttaactcttcctatt
atgccgagtgattatcccttgtcgttggaagagattgaaaaagagttagaaaacaatatt
cagggcattttaggttacgtggtgcgttgggttgaaatggggataggctgttcaaaagta
cctgatattaacaatgtcggattaatggaggatcgcgctaccttgcgtatttcaagtcag
catattgccaactggttaaaacataatatatgcagcactgaacaagtaaatcgtattatg
cgcaatatggcagaaattgtagataaacaaaatgcaggggtatctggttatcagaacatg
tctcctaattatgaaacaaattacgcatttcaggccgcagaagcgttgatttttgaaggt
gaagatcaacccaatggatatacagagccgttattacatgagtacagaatgttcgcaaaa
atttcctag

DBGET integrated database retrieval system