KEGG   Psychromonas ingrahamii: Ping_0303Help
Entry
Ping_0303         CDS       T00450                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pin  Psychromonas ingrahamii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_0303
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_0303
   00630 Glyoxylate and dicarboxylate metabolism
    Ping_0303
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ping_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
397705..399873
Genome map
AA seq 722 aa AA seqDB search
MNLPQQKQSEIESGFYNFINQEVLPHTNLNADDFWFDLMKLVNDFSPLNSQLLATRKTMQ
KQIDDWHRSHQNFDQQDYLKFLEEIGYLVEQGESFNIETENVDSEISTLAGPQLVVPVQN
ARFALNAANARWGSLYDAYYGTDLIQKTGALKPGSDFNVARGQRVITLAKDFLDEVFPLD
SGSHHDVLSYLVYYQHLLAFFPDGSKTGLKTPAQFIALDGSKSDPSYLLLKNNGLHIGIV
IDRHGKIGCSDLSGIDDIQVESALTTIIDFEDSISAVDAEDKVEAYKNWLGLIKGDLSAN
FSKDGEQMTRQLNQDKAFIDKDGEKYVVHGRALLLVRNVGHLMGSDLIQDSEGNNAPEGI
IDAAITALIGSIDLQEKTNNNIRNSRSGSIYIVKPKMHGPDEVAFTCDLFSRVEEMLKLQ
PNTIKLGIMDEERRTSANLKECIRVAKSRVVFINTGFLDRTGDEIHTSKEAGAVYPKALI
KTLPWFDAYENNNVDVGLACGFSGKAQIGKGMWAMPDEMKKMMKEKIQHPLSGANTAWVP
SPTAAILHALHYHQVDVFKEQLKIAKRPAAKQTDLLTLPIMPSDYPLSLEEIEKELENNI
QGILGYVVRWVEMGIGCSKVPDINNVGLMEDRATLRISSQHIANWLKHNICSTEQVNRIM
RNMAEIVDKQNAGVSGYQNMSPNYETNYAFQAAEALIFEGEDQPNGYTEPLLHEYRMFAK
IS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaccacaacaaaaacagagtgaaattgagtcaggtttttacaatttcatcaat
caagaagtactgccacatacaaatttgaatgctgatgatttctggtttgacttaatgaaa
ttggtcaacgatttttcaccacttaattcgcagttattagccacgcgtaaaacaatgcag
aagcagattgatgattggcatcggtcgcatcagaactttgatcaacaggactacctgaaa
tttttagaagaaatcggttatttagttgagcagggcgagtcctttaatatcgaaacagag
aatgtggacagtgaaatatccacattagcaggaccgcaactggttgtaccggtacaaaat
gcacgctttgcattaaatgctgccaatgccagatggggcagtttatacgatgcctattac
ggcactgatcttatccagaaaaccggcgcgttaaaacccggttctgactttaatgtagcc
cgcggccaacgtgtgattaccttagctaaagactttcttgatgaggtgttcccgctggat
agcggctcgcaccatgatgttttaagctatttagtttattaccagcatcttctggctttt
ttcccggatggcagtaaaaccggcttaaaaacccccgctcagtttattgcattggatggt
tcgaaaagcgatccgagttatcttctgctgaaaaacaatggcttacatattggcattgtg
attgatcgccacggtaaaattggctgttcagatctttccggcattgatgatattcaagtt
gaatctgctttgacgactatcatagattttgaagactcgatttctgctgtggatgctgag
gataaagttgaagcctacaaaaactggctgggtttaatcaaaggtgatttaagcgcaaat
ttcagcaaagacggcgagcagatgacacggcagcttaatcaggacaaagccttcatcgac
aaagacggtgagaaatatgttgttcacggacgagccttgctactagtgcgtaatgttggt
cacttaatgggcagcgatttaatccaggacagtgagggcaacaatgctcccgaaggtatt
attgatgctgcgattaccgcgttaatcggcagtatcgatttacaggaaaaaacgaataat
aatatccgcaatagtcgtagcggcagcatctatattgttaaacctaaaatgcatgggccg
gacgaagtcgctttcacctgtgacttgttcagccgcgtggaagagatgcttaaactgcag
cctaataccattaaactgggcattatggatgaagaacgccgtacatcggcaaatctcaaa
gagtgtattcgggtagcaaaatcacgggtggtctttattaataccggtttcttagacaga
accggtgatgaaatccataccagtaaagaagcgggtgctgtttatcctaaagcgctgatc
aaaaccctgccctggtttgatgcttacgaaaataacaatgtagatgttggactcgcctgt
ggattctctggaaaagcgcagattggtaaaggcatgtgggcaatgcccgatgaaatgaaa
aaaatgatgaaggaaaaaattcaacatcctttatcgggtgccaataccgcttgggtaccg
tcgcctaccgccgcgatattacatgctttacattatcaccaggtggatgtttttaaagaa
cagctgaaaatagcgaagcgcccggctgccaagcagacggatttgttaactcttcctatt
atgccgagtgattatcccttgtcgttggaagagattgaaaaagagttagaaaacaatatt
cagggcattttaggttacgtggtgcgttgggttgaaatggggataggctgttcaaaagta
cctgatattaacaatgtcggattaatggaggatcgcgctaccttgcgtatttcaagtcag
catattgccaactggttaaaacataatatatgcagcactgaacaagtaaatcgtattatg
cgcaatatggcagaaattgtagataaacaaaatgcaggggtatctggttatcagaacatg
tctcctaattatgaaacaaattacgcatttcaggccgcagaagcgttgatttttgaaggt
gaagatcaacccaatggatatacagagccgttattacatgagtacagaatgttcgcaaaa
atttcctag

DBGET integrated database retrieval system