KEGG   Psychromonas ingrahamii: Ping_0304Help
Entry
Ping_0304         CDS       T00450                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00630  Glyoxylate and dicarboxylate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01200  Carbon metabolism
Module
pin_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ping_0304
Enzymes [BR:pin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ping_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ABM02170
JGI: Ping0304
UniProt: A1SRQ5
Position
399941..401536
Genome map
AA seq 531 aa AA seqDB search
MNYNTEKTNASNVIAQQGDAWKAINPEYVARLRSQNRFKTGIDIAKYTAKIMREDMDSYD
IDSKNYTQSLGCWHGFVGQQKMISIKKHFTTTKGTYLYLSGWMVAAMRSEFGPLPDQSMH
EKTSVPLLIEELYTFLKQADARELGHVFQELDAANDKGDQVAAQAALKKINEFETHVVPI
IADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKIN
AVRYAFMELGVDDGVIVARTDSLGAGLTQKIPVSQEPGDLADQYNNYIDGEVINSLDQLK
SGDLVLSRGGELIIPNRLANGLVRFKPDTGEDRVVLDCITSLQNGADLLWIETEQPNVGQ
IAGMVNRIREAVPNAKLVYNNSPSFNWTLSFRQQIFDTWNKDGIDVSAYNRADLMSPIYD
ETKLALEADQQIQNFQKDAAREAGIFHHLITLPTYHTAALSTDNLAKDYFGEMGMLAYVK
NVQREEIRQGLACVKHQDMSGSNMGDDHKEYFSGEQALKASGENNTMSQFS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaactataatactgaaaaaactaatgctagcaatgttattgcacaacagggtgatgct
tggaaggcgattaatcctgagtatgttgcccgtttgcgctcacaaaaccgctttaaaaca
ggtattgatattgctaaatatacagcgaagataatgcgcgaagatatggattcatatgat
atcgacagtaaaaattatactcagtctctaggttgctggcatggatttgtcggtcagcaa
aaaatgatctctattaaaaagcattttacgacgactaaaggtacttatttatacctttcc
ggttggatggttgcggcaatgcgctctgaatttggcccgcttcctgatcagtcaatgcat
gaaaagaccagtgttccgttgttaatagaagagctttatactttcttaaaacaagctgat
gcccgtgaacttggtcatgtctttcaagagttagatgcagccaatgataaaggtgatcaa
gtagcagcgcaggcggctctaaagaaaatcaatgaatttgaaacacatgttgtgccgatt
atcgccgatattgatgcgggttttggtaatgaagaagcaacttacctactagctaaaaaa
atgattgaagccggtgcttgttgtattcagattgaaaaccaggtatccgatgctaaacag
tgtggtcaccaggatggcaaagtaactgtcccgcatgaagacttcctcgctaagattaat
gcagtacgttatgcatttatggagttgggtgttgacgatggcgttattgttgcgcgaact
gattctttaggtgctggtttaactcaaaaaattccagtatcccaagagccaggcgatctt
gctgatcagtataataactatattgacggcgaagtaatcaactctttagatcagttgaaa
tcgggagatctcgtactgagtcgtggtggagaattgattataccaaaccgtttagccaat
ggcctggtacgttttaaacctgatactggcgaagacagagtagtacttgattgtattact
tctctacaaaatggtgctgatttattgtggattgaaacggaacaacctaacgttgggcaa
attgctggtatggttaaccgtatccgcgaagcggttccaaatgccaagcttgtttataat
aacagtccatcatttaactggacattaagctttagacagcagatttttgatacttggaat
aaagatggtattgatgtttcagcttataaccgtgcagatttgatgagcccaatctatgat
gagactaaattagctcttgaagctgaccaacaaattcagaacttccagaaagatgcggca
agagaagcaggtattttccatcacttgataactttaccgacttaccatactgcagctttg
tcgactgataatcttgctaaagattactttggtgaaatgggtatgctggcttatgttaaa
aatgtacagagagaagaaattcgtcagggtcttgcatgtgtaaaacatcaggatatgtcc
ggctctaatatgggcgatgatcacaaagaatatttctctggagagcaggcgctgaaagct
tctggtgaaaataatacgatgagtcaattttcataa

DBGET integrated database retrieval system