KEGG   Psychromonas ingrahamii: Ping_0316Help
Entry
Ping_0316         CDS       T00450                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00860  Porphyrin and chlorophyll metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
Module
pin_M00121  Heme biosynthesis, glutamate => heme
pin_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ping_0316
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ping_0316
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ping_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABM02182
JGI: Ping0316
UniProt: A1SRR7
Position
complement(416727..417734)
Genome map
AA seq 335 aa AA seqDB search
MTISQHFPARRLRRLRKHDFSRRLVAENQLSASDLIYPMFVVEGKNQREKIKSMPGIERL
SIDLLVAEAKQLVALGIPAIALFPVTPDNIKTEMAEEAYNPEGLAQRAVRSVKEACPELG
VITDVALDPFTTHGQDGIIDKEGYVLNDITTEILVKQALSHAQAGADIVAPSDMMDGRIG
AIREALENAGFINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGNKSTYQMDPANSDEAI
HEVALDIQEGADMVMVKPGMPYLDIVRRVKTELQVPTFAYQVSGEYAMHKAAIDNGWLKE
RETVLESLLCFKRAGANGILTYFAKQVAIWLQENK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttctcagcacttccctgcgcgacgcttgcgtcgtttgcgtaagcatgatttt
tctcgtcgtttagttgccgaaaaccagctttctgcaagcgatcttatttatccaatgttt
gttgttgaagggaaaaaccaacgcgaaaagataaagtctatgccgggtatcgagcggctt
tcaattgatttactggtggcagaagcaaagcagttagtggcattaggcattccagctatt
gccctgtttccggtgacaccggacaatataaaaaccgagatggccgaggaagcatacaac
cccgaggggcttgctcaacgcgcggtaagaagtgttaaagaggcttgtcctgaattaggg
gtgatcaccgatgtggcactggatcctttcactacccacggacaagacggtattattgat
aaagagggctatgtattaaatgacattacaaccgagatactggttaagcaagccctttcc
catgcgcaagcgggtgccgatattgtcgcaccgtcagatatgatggatggtcgtattggt
gctattcgtgaagcattggaaaatgccggatttattaatacccaaataatggcttacagt
gctaaatatgcgtcaaactactacggcccttttcgggatgccgtcggcagcgccggcaat
ttaaaaggtggcaataaatcaacctaccaaatggatcccgccaacagtgatgaagcaatt
catgaagttgcactggatattcaagagggcgctgatatggtcatggttaaacccggcatg
ccctatttagacatagtccgccgtgttaaaactgaactgcaggtccctacttttgcatac
caggtaagtggcgaatatgcgatgcataaagcggctatagataatggttggttaaaagag
cgcgaaacggttttagaatctttactttgttttaaacgtgcaggggcaaacggcattctg
acctactttgccaagcaggtcgctatttggttacaagaaaataaataa

DBGET integrated database retrieval system