KEGG   Psychromonas ingrahamii: Ping_0344Help
Entry
Ping_0344         CDS       T00450                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pin  Psychromonas ingrahamii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ping_0344
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ping_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
445648..446574
Genome map
AA seq 308 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGTGYAVIPGGKGANQAVAAARLGADVAFIAC
LGDDSFGINIRDAFKSDGINVDGVMIEKNTPTGIAMIQVSATGENSICISAEANNHLTPE
RIKPFSSLISAAEILLMQLETPIETIQAAAETAKLAGTVVVLNPAPAQSLSDELLKLVDI
ITPNETEAEQLTGVQVKDMPSAQQAAEKLHDKGIEMVMITLGSEGVWLSQAGKGKQIKGF
TVKAVDTTAAGDTFNGALLTRLLEKASVEESIRFAHAAAAITVTGKGAQTSIPDRQSVEK
FLQQMDNK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagtcgttctgggcagcgttaacgccgatcatgttttacaagttccctct
tttccgcgtcccggagaaactctgcacggcacaggctatgctgttattcccgggggaaag
ggcgccaaccaggctgtcgcagctgcgcgtttgggcgccgatgtggcatttattgcctgc
ttgggtgatgatagtttcgggattaatattcgtgacgcttttaaaagcgatggaatcaat
gttgatggggtgatgattgaaaaaaacaccccaacagggatcgcaatgattcaagtatcg
gccaccggagagaacagtatttgcatctcagccgaagccaataatcacctcacacctgaa
cgtataaaacctttttcctctcttattagcgcagctgaaatattactgatgcaattggaa
acgcctattgaaacgatccaggccgctgctgaaacggcaaaactcgccgggacagtggtt
gtcttaaatccggcacctgcgcaatcattaagcgatgagttgttaaaacttgttgatatt
atcacccccaatgaaaccgaagctgagcagcttacgggtgttcaagtcaaggatatgccc
tcggcacaacaagccgctgaaaagttacatgacaagggtatcgaaatggtaatgataacc
ctaggcagtgagggggtatggctgagccaggctggtaagggtaagcagataaaaggcttt
accgtgaaagctgtggatacaacagccgcaggagatactttcaacggtgcgctattgacc
cgcttgctggaaaaggcaagcgtggaagaatcgattcgttttgcccatgcggctgccgcg
atcacggtcaccggtaaaggggcacaaacatcgattccagatcgccagagtgtagagaaa
tttttacagcagatggacaataaatga

DBGET integrated database retrieval system