KEGG   Psychromonas ingrahamii: Ping_0591Help
Entry
Ping_0591         CDS       T00450                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_0591
   01230 Biosynthesis of amino acids
    Ping_0591
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_0591
   00030 Pentose phosphate pathway
    Ping_0591
   00051 Fructose and mannose metabolism
    Ping_0591
   00052 Galactose metabolism
    Ping_0591
  Energy metabolism
   00680 Methane metabolism
    Ping_0591
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ping_0591
Protein phosphatases and associated proteins [BR:pin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ping_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
773058..774020
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRAVVREGLHLGLEVYGIFDGYEGLHQGKIKPLDRNSVSD
VINRGGTFLGSARFPEFKQQKTREEAIENLKKYGIDALVVIGGDGSYMGAKKLTEMGYPC
IGIPGTIDNDIPGTTYTIGFDTALNIVVEAIDRLRDTSASHKRISIVEIMGRYCGDLTLG
AAVAGGAEFVVIPEKGYSEAELLGQIKAGIAKGKTHMIIAMCEHVTKVDKLAEHIQAETG
HDTRATILGHIQRGGTPTAQDRILASRMGSFAVKLLLEDQGGRCIGVVNSQMVHYDIIDC
INNMKRPFNQELFDLSDSLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagaataggggttttaacaagtggaggcgatgcacccggtatgaatgcggca
atccgtgccgtagtacgtgaaggcttacatcttggtttagaagtctatggtatctttgat
ggttatgaagggttgcatcaaggtaagattaagccactcgatcgtaattctgtttctgat
gtcattaaccgtggcggtacttttttaggctcggcacgtttccctgaatttaaacaacaa
aaaacccgtgaagaagccattgaaaatcttaaaaaatacggtattgatgccttagtggtt
attggtggtgatggttcatacatgggggctaaaaaactcacagaaatgggttacccctgt
atcggtattccaggcactattgataatgatattccaggtacaacttatactatcggtttt
gatactgcactaaatatcgttgttgaagcaattgaccgtctacgtgatacctctgcatca
cacaaacgtatctccattgttgaaatcatgggtcgttactgtggtgatttaaccttaggt
gccgctgtcgcgggcggtgctgaatttgttgtaattccagaaaaagggtatagcgaagct
gagttactggggcaaatcaaagccggtattgcaaaaggtaaaacccatatgattatcgcc
atgtgtgagcacgtaacaaaggttgataaacttgcggagcatatccaagctgaaaccggc
catgatacacgtgcaaccattttaggtcatatccaacgtggcggtacaccgacagcccaa
gatcgcattttggcgagtcgtatgggatcttttgctgttaagctgttattagaagatcaa
ggcggtcgttgcattggcgtcgtgaattcacaaatggttcactatgatattattgattgt
atcaacaatatgaaacgaccttttaatcaagaattatttgatctgtcggactctttattc
tga

DBGET integrated database retrieval system