KEGG   Psychromonas ingrahamii: Ping_0655Help
Entry
Ping_0655         CDS       T00450                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00071  Fatty acid degradation
pin00280  Valine, leucine and isoleucine degradation
pin00281  Geraniol degradation
pin00310  Lysine degradation
pin00360  Phenylalanine metabolism
pin00362  Benzoate degradation
pin00380  Tryptophan metabolism
pin00410  beta-Alanine metabolism
pin00627  Aminobenzoate degradation
pin00640  Propanoate metabolism
pin00650  Butanoate metabolism
pin00903  Limonene and pinene degradation
pin00930  Caprolactam degradation
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ping_0655
   00650 Butanoate metabolism
    Ping_0655
  Lipid metabolism
   00071 Fatty acid degradation
    Ping_0655
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ping_0655
   00310 Lysine degradation
    Ping_0655
   00360 Phenylalanine metabolism
    Ping_0655
   00380 Tryptophan metabolism
    Ping_0655
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ping_0655
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ping_0655
   00281 Geraniol degradation
    Ping_0655
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ping_0655
   00627 Aminobenzoate degradation
    Ping_0655
   00930 Caprolactam degradation
    Ping_0655
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ping_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABM02508
JGI: Ping0655
UniProt: A1SSP3
Position
840654..841439
Genome map
AA seq 261 aa AA seqDB search
MTLNNESNFLQCSEKKGVLLIQFTHYEKRNALSNDCLNELAGVLDKAEQQNHIAAVVLTG
GQRCFAAGADLNELATQGAIDTWLNPRPELWARLNKFSKPLLAAVNGYALGAGLELVLLC
DIAISGQKALFGLPEITLGLIPGAGGTQRLARTVGKSLTNQMVLTGLPITAERALQAGLI
SEVVIPELTLERTIIIAETIAKRAPLAIKAAKQSLQQVPNSSLDQGLKFERQLFVTLAAS
NDRKEGIDAFFNKRQPTYKGS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgactttaaataatgaatcaaattttcttcaatgctctgaaaaaaagggtgtgctgtta
atacaatttacgcattacgaaaaacgtaatgcactttcaaatgactgccttaatgaactg
gcaggggtattagataaagccgagcaacagaatcatattgctgcggtcgtgctaaccggt
ggacaacgttgttttgctgcaggtgcagatcttaatgagttagcaacgcaaggtgctatt
gatacctggttgaaccccagacctgaattatgggcgcgtttaaataagtttagcaaacct
ttattagccgctgtgaatggttatgccttaggagccggccttgagttagttctactgtgt
gatattgccatttcaggacaaaaagccctgtttggtttgccggaaataaccttaggatta
ataccgggtgctggtggcacacaacgtttagcgcggacagtcggtaaatctttgactaat
caaatggtactgactgggcttccgatcacggccgaacgcgctttacaagcaggtcttatt
agtgaagttgttattcctgagttaacacttgagcgcaccatcatcattgccgaaacaata
gcaaaacgcgcgccgcttgcgataaaagctgccaaacaatctctgcagcaagttcctaat
agcagcttggatcaaggcttaaaattcgagcgtcaattgtttgtcacattagccgcaagc
aacgatagaaaagaaggcattgatgctttttttaacaagcgtcaaccgacctataaaggg
agttag

DBGET integrated database retrieval system