KEGG   Psychromonas ingrahamii: Ping_1056Help
Entry
Ping_1056         CDS       T00450                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ping_1056
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_1056
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ping_1056
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ping_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1329738..1330925)
Genome map
AA seq 395 aa AA seqDB search
MEKLNPYFGQFGGMFVPQILVPALKQLEAEFVRAQTDPEFLAELSELLTEYAGRPTPLTL
CRNLTKGKKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAAAL
ACALLGLKCRVYMGAVDCERQKPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWAGSY
DTAHYLLGTVAGPHPFPTIVREFQKIIGEEAKQQVLKKEGVLPDKVIACVGGGSNAIGIF
NDFIDDPSVELIGVEPGGRGIETGKHGCPITYGSKGIFFGMHSLMMQDKHGQVKESYSIS
AGLDFPSVGPQHAHLAETGRAQYVYATDDEALDAFHELSLKEGIIPALESAHALAHALKL
IKHDDKEQIIIVNLSGRGDKDIFTVAEIFEERGIL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactaaatccttactttggtcaatttggtggtatgtttgtaccccaaattctg
gtccccgcattaaaacagttagaagctgaatttgtaagagcgcaaacagatcctgaattt
ttagcagagttatctgaattattaaccgaatatgcaggtcgcccgacgcccttaacatta
tgtcgcaacctgactaaaggtaaaaaaaccaaactttaccttaaacgcgaagatctgctc
cacggaggtgcacataaaaccaaccaagttttagggcaggcattactcgctaaacgcatg
ggtaaaaaagaaattattgcagaaacgggtgccggccaacacggtgttgcagcggcatta
gcttgtgcattacttggacttaaatgtcgtgtttatatgggtgctgtggattgtgaacgt
caaaaacccaatgtcttccgtatgcgtttaatgggcgcggaagtgattcccgttcattcc
ggttcatcaacattaaaagatgcctgtaatgaagcattgcgtgattgggctggcagttat
gatactgcgcactatttattagggacagtggccggcccacacccttttccaacgattgta
cgtgaattccagaaaataattggtgaagaagcgaagcagcaggtattaaaaaaagaaggt
gtgctacctgataaagtgattgcctgtgtcggcgggggctctaacgccatcggtatattc
aatgattttatagacgatccaagcgttgaactgattggtgttgagccaggaggacgcggt
attgaaaccggtaaacacggttgccctatcacctatggttcaaaaggtatcttctttggt
atgcattccttaatgatgcaggataaacatggtcaggttaaagagtcttattcgatctct
gccggacttgatttcccgtccgttggtccgcaacatgctcaccttgcagaaacgggacgc
gcccaatatgtttacgctaccgatgacgaagcgctagatgctttccatgaactctcttta
aaagaaggtattattccggctcttgagtccgcacacgcattagcacatgccttaaaacta
attaaacatgatgataaggagcaaatcattattgttaatttatccggccgtggtgataaa
gatatctttaccgtcgctgaaatttttgaagaaagaggaattctctaa

DBGET integrated database retrieval system