KEGG   Psychromonas ingrahamii: Ping_1064Help
Entry
Ping_1064         CDS       T00450                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pin  Psychromonas ingrahamii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ping_1064
   00052 Galactose metabolism
    Ping_1064
   00500 Starch and sucrose metabolism
    Ping_1064
   00520 Amino sugar and nucleotide sugar metabolism
    Ping_1064
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ping_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339132..1339959
Genome map
AA seq 275 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPIVNKPLIEFGVDEALEAGMTNMCIVTGRGKH
SLMDHFDLNYELEHQINGTPKEDKLKDIRLIMDRANFTYIRQREMKGLGHAILVGKELIG
DEPFAVVLADDLCINHANGVLKQMVDLYKQFRCSIVAVEEVPEDQIHKYGVIKGEMIKDN
IYRVDDMVEKPAPGTAPSNLAIIGRYILTPDIFDIIEETTPGKGGEIQITDALLTQAKRG
CVLAYKFKGKRFDCGSVPGYIEATNYVYDNIYEDK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtttatttcccgcagcgggttatggtacccgttttttaccggccacc
aaatcaatgccaaaagagatgatgccgattgttaacaaaccgcttattgagtttggtgtt
gatgaagccttagaagccggcatgactaatatgtgtatcgttaccgggcgtggtaaacac
tctttaatggatcattttgatcttaattatgaattagagcatcaaatcaacggcacaccg
aaagaagataaattaaaagatattcgattaataatggatcgggcaaatttcacttatatt
cgtcaacgcgaaatgaaaggtctgggccatgctattttagttggtaaagagttgattggt
gatgaaccttttgctgtggtacttgctgatgatctgtgtatcaatcatgctaatggtgtt
ttaaaacagatggttgatttgtacaaacaattccgttgctcaatcgtggccgttgaagag
gtgcctgaagatcagatacacaaatacggggtaatcaaaggggagatgatcaaagataat
atttaccgtgttgatgatatggtcgaaaagcctgcacccggcacagccccgagtaattta
gctattattggtcgttatatattaacgcctgatatttttgatattattgaggagacaact
cccggtaaaggtggcgaaatacaaattaccgatgcgctactgacacaggctaaaagagga
tgcgtgctggcttataaatttaaaggtaagcgttttgattgtggtagtgtaccgggatat
attgaagctacaaattatgtttatgataatatttacgaagataaataa

DBGET integrated database retrieval system