KEGG   Psychromonas ingrahamii: Ping_1142Help
Entry
Ping_1142         CDS       T00450                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00300  Lysine biosynthesis
pin00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ping_1142
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ping_1142
Enzymes [BR:pin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ping_1142
Peptidoglycan biosynthesis and degradation proteins [BR:pin01011]
 Precursor biosynthesis
  Amino acid ligase
   Ping_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Glycos_transf_2 FHIPEP
Motif
Other DBs
NCBI-ProteinID: ABM02979
JGI: Ping1142
UniProt: A1SU14
Position
1429469..1430998
Genome map
AA seq 509 aa AA seqDB search
MHNDSQIMLLDDLIKPWLSDYDPSIRVSGLTLDSRQICRGYLFIALQGAQHDGRLFIEKS
LKMGACAVLSETKNRSEHGQVTIKSGVPVFAVYKPAAILSALAYRFFFRKIKLHKVIAVT
GTNGKTTIASLLADSFMLLGKQSAQMGTIGNGLFGQLKSSLNTTLDAISVFSELHCYQQQ
RAEYTIMEVSSHGLDQGRVSAVPFFSAIFTNLTRDHLDYHGSMENYHLAKKSLFEKYPLK
QRIINADDPIGAQWLTDFPDAISYGFNAKALTDKQSYLRVTDVDYHAQGVTFAFHSSWGK
GVVSAPFYGDFNVSNLAAVLTQLLVENVSIEHVQTIFPKLSTVPGRMEQYYFAEKNITFV
VDYAHTPDALEKVLLALQKHKSSGRLICVFGCGGDRDTGKRPQMANIAESYAQKVVLVDD
NPRTENAQSIIEDILQGFARPDRVEVIHDRRQAVNFLLNSAQSDDIVLLAGKGHEDYQIF
GTQRVHYSDRECLASLQKSADLVDYSAHK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcataacgactcgcaaataatgttattagacgatttgattaaaccttggttaagtgac
tatgatccttcgattagggtctccggtctaaccttagacagtcgtcaaatttgccgtggt
tacctgtttatcgcacttcagggagcacaacatgacgggcgtttatttattgaaaaaagc
ctcaaaatgggcgcttgtgctgttttatcggaaactaaaaaccgatccgagcatggtcag
gtaactataaaatcaggtgtgccagtgttcgcagtttacaaacctgcggctattttaagt
gcactagcctatcgtttcttttttaggaaaatcaagttacataaagtgattgctgtgacg
gggaccaatggaaaaaccacgatagcaagtttgttagctgacagttttatgctcttaggt
aaacagagcgcgcaaatgggcaccattggaaacggtttattcgggcaattaaaaagcagc
ttaaatacaaccttagacgctatatcggtattttctgagttgcattgttatcagcagcag
agggctgaatatacgataatggaagtctcctctcatggactggaccaggggcgtgtttcc
gccgtacctttttttagcgcaatatttactaatttaacccgcgatcaccttgattatcat
ggctcgatggagaattatcatttagctaaaaaaagcctatttgaaaagtatcctctcaag
caacgtatcatcaatgcagatgacccaatcggcgcacagtggttaactgattttccggat
gctatcagttatggttttaatgccaaagccttaactgataaacaatcttatctacgggta
acagatgttgattatcatgctcaaggtgtcacttttgcatttcactcaagttgggggaag
ggagtcgtatcagcccccttttatggtgatttcaatgtgtcaaatttggctgctgtatta
acgcaattattggtagaaaatgtcagcatagaacatgtacaaacaatctttcctaaatta
agtaccgtgcctgggcggatggaacagtattactttgcggaaaaaaacatcacctttgtg
gttgattacgcacatacacccgatgcattagagaaggtattactggcactgcagaaacat
aaatcttcaggtcgtctgatttgtgttttcggctgtggtggggaccgcgatacgggtaaa
cgtccacaaatggctaacattgcggaatcttatgctcaaaaagtggtgttggttgatgat
aatccacgcacagaaaatgctcagagtatcattgaagatatattacaaggttttgccaga
cccgatagagttgaggtgatccatgatcgccgccaagcagtgaattttttattaaattca
gcacaatccgatgatattgtgctgctggctgggaagggacatgaagattaccaaatcttt
ggcacacaacgcgtgcattatagcgatcgagaatgtttagcttcattacaaaaatcagcc
gatctggtcgattattctgcacataaataa

DBGET integrated database retrieval system