KEGG   Psychromonas ingrahamii: Ping_1277Help
Entry
Ping_1277         CDS       T00450                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ping_1277
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_1277
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ping_1277
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ping_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1584305..1585582
Genome map
AA seq 425 aa AA seqDB search
MKLYNIKDNSEQVNFQQAVKQGLGRGQGLFFPKEITPLDNIDALLKMNLVDRSTEILSHL
IGDELSKEVLHSIVSKAFTFDAPVKKVTDNINALELFHGPTLAFKDFGGRFMAQCLAEFK
GDDKITILTATSGDTGAAVAHAFFNMENINVVILYPKGKISPLQEKLFCTLGGNITTVAI
EGTFDDCQTMVKQAFDDQELKQAVGLNSANSINISRLLAQICYYFEALAQLSAAQRNNLV
VSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNENDTVPRYLEEGTWTPKATVATISNAMD
VSQPNNWPRIEELFKIQGWSLSELGYGMLNDAQTRASLLELDNLGYLCEPHGAIAYAELT
KQLKEDETGLFLCTAHPAKFKESVEDILGRDIFIPEELASRANLDLLSKEFPADFAMVRA
LLMSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacaacatcaaagacaacagtgagcaagtcaactttcaacaagctgttaag
caaggtttaggacgtggccagggacttttttttccaaaagaaatcacgcctcttgataat
attgatgcacttttgaaaatgaatttagttgatcgctcgactgaaattttatctcactta
attggtgatgagttaagtaaagaagtgcttcacagtattgtatcaaaagcttttactttc
gatgcgccggtaaaaaaagtgacggataacattaatgccttggaactttttcatggtcca
accttagcatttaaagattttggcggtcgttttatggcccagtgtttagccgaatttaag
ggagacgataaaattactattttaacggcaacctctggtgatactggtgccgctgttgct
catgcctttttcaatatggaaaacattaatgttgttattctgtacccaaaaggaaaaatc
agcccgctgcaagaaaaactgttctgtacattaggtggtaatattaccactgtcgctatt
gaaggcacctttgatgattgccaaacaatggttaagcaggcttttgatgatcaagaatta
aagcaggccgttggcctaaactcagcaaattcaatcaatattagccgcctgctggcacaa
atctgttactactttgaagccctggcgcagctatctgccgcgcagcgcaataatttagtt
gtttctgtacccagtggtaattttggcgatttaactgcgggtttgctcgctaaatcttta
gggttgccgattaaacgttttatcgcagcgaccaatgaaaatgatacggttccccgttac
ctggaggaaggaacttggacgcctaaagcgacggttgctacgatttcaaatgcgatggat
gtcagtcagcccaataattggccacgtattgaagaattatttaaaatacaaggttggtca
ctatcagaacttgggtacggcatgttaaacgatgcacaaacgcgtgccagtctgcttgaa
ttggataatttaggttacttatgtgaacctcatggcgcaattgcttacgctgaacttact
aaacaattaaaagaagatgaaacaggtttattcttgtgtacagcgcatcctgctaagttt
aaagaaagcgtagaagatattttagggcgtgatattttcattccggaagagcttgcttct
cgtgcgaatttagatttattatcaaaagaatttcctgctgattttgcaatggttagagca
ctattgatgtctttgtaa

DBGET integrated database retrieval system