KEGG   Psychromonas ingrahamii: Ping_1277Help
Entry
Ping_1277         CDS       T00450                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00260  Glycine, serine and threonine metabolism
pin00750  Vitamin B6 metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01230  Biosynthesis of amino acids
Module
pin_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_1277
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ping_1277
Enzymes [BR:pin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ping_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABM03104
JGI: Ping1277
UniProt: A1SUD9
Position
1584305..1585582
Genome map
AA seq 425 aa AA seqDB search
MKLYNIKDNSEQVNFQQAVKQGLGRGQGLFFPKEITPLDNIDALLKMNLVDRSTEILSHL
IGDELSKEVLHSIVSKAFTFDAPVKKVTDNINALELFHGPTLAFKDFGGRFMAQCLAEFK
GDDKITILTATSGDTGAAVAHAFFNMENINVVILYPKGKISPLQEKLFCTLGGNITTVAI
EGTFDDCQTMVKQAFDDQELKQAVGLNSANSINISRLLAQICYYFEALAQLSAAQRNNLV
VSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNENDTVPRYLEEGTWTPKATVATISNAMD
VSQPNNWPRIEELFKIQGWSLSELGYGMLNDAQTRASLLELDNLGYLCEPHGAIAYAELT
KQLKEDETGLFLCTAHPAKFKESVEDILGRDIFIPEELASRANLDLLSKEFPADFAMVRA
LLMSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacaacatcaaagacaacagtgagcaagtcaactttcaacaagctgttaag
caaggtttaggacgtggccagggacttttttttccaaaagaaatcacgcctcttgataat
attgatgcacttttgaaaatgaatttagttgatcgctcgactgaaattttatctcactta
attggtgatgagttaagtaaagaagtgcttcacagtattgtatcaaaagcttttactttc
gatgcgccggtaaaaaaagtgacggataacattaatgccttggaactttttcatggtcca
accttagcatttaaagattttggcggtcgttttatggcccagtgtttagccgaatttaag
ggagacgataaaattactattttaacggcaacctctggtgatactggtgccgctgttgct
catgcctttttcaatatggaaaacattaatgttgttattctgtacccaaaaggaaaaatc
agcccgctgcaagaaaaactgttctgtacattaggtggtaatattaccactgtcgctatt
gaaggcacctttgatgattgccaaacaatggttaagcaggcttttgatgatcaagaatta
aagcaggccgttggcctaaactcagcaaattcaatcaatattagccgcctgctggcacaa
atctgttactactttgaagccctggcgcagctatctgccgcgcagcgcaataatttagtt
gtttctgtacccagtggtaattttggcgatttaactgcgggtttgctcgctaaatcttta
gggttgccgattaaacgttttatcgcagcgaccaatgaaaatgatacggttccccgttac
ctggaggaaggaacttggacgcctaaagcgacggttgctacgatttcaaatgcgatggat
gtcagtcagcccaataattggccacgtattgaagaattatttaaaatacaaggttggtca
ctatcagaacttgggtacggcatgttaaacgatgcacaaacgcgtgccagtctgcttgaa
ttggataatttaggttacttatgtgaacctcatggcgcaattgcttacgctgaacttact
aaacaattaaaagaagatgaaacaggtttattcttgtgtacagcgcatcctgctaagttt
aaagaaagcgtagaagatattttagggcgtgatattttcattccggaagagcttgcttct
cgtgcgaatttagatttattatcaaaagaatttcctgctgattttgcaatggttagagca
ctattgatgtctttgtaa

DBGET integrated database retrieval system