KEGG   Psychromonas ingrahamii: Ping_1277Help
Entry
Ping_1277         CDS       T00450                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pin01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pin00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pin00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1584305..1585582
Genome map
AA seq 425 aa AA seqDB search
MKLYNIKDNSEQVNFQQAVKQGLGRGQGLFFPKEITPLDNIDALLKMNLVDRSTEILSHL
IGDELSKEVLHSIVSKAFTFDAPVKKVTDNINALELFHGPTLAFKDFGGRFMAQCLAEFK
GDDKITILTATSGDTGAAVAHAFFNMENINVVILYPKGKISPLQEKLFCTLGGNITTVAI
EGTFDDCQTMVKQAFDDQELKQAVGLNSANSINISRLLAQICYYFEALAQLSAAQRNNLV
VSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNENDTVPRYLEEGTWTPKATVATISNAMD
VSQPNNWPRIEELFKIQGWSLSELGYGMLNDAQTRASLLELDNLGYLCEPHGAIAYAELT
KQLKEDETGLFLCTAHPAKFKESVEDILGRDIFIPEELASRANLDLLSKEFPADFAMVRA
LLMSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacaacatcaaagacaacagtgagcaagtcaactttcaacaagctgttaag
caaggtttaggacgtggccagggacttttttttccaaaagaaatcacgcctcttgataat
attgatgcacttttgaaaatgaatttagttgatcgctcgactgaaattttatctcactta
attggtgatgagttaagtaaagaagtgcttcacagtattgtatcaaaagcttttactttc
gatgcgccggtaaaaaaagtgacggataacattaatgccttggaactttttcatggtcca
accttagcatttaaagattttggcggtcgttttatggcccagtgtttagccgaatttaag
ggagacgataaaattactattttaacggcaacctctggtgatactggtgccgctgttgct
catgcctttttcaatatggaaaacattaatgttgttattctgtacccaaaaggaaaaatc
agcccgctgcaagaaaaactgttctgtacattaggtggtaatattaccactgtcgctatt
gaaggcacctttgatgattgccaaacaatggttaagcaggcttttgatgatcaagaatta
aagcaggccgttggcctaaactcagcaaattcaatcaatattagccgcctgctggcacaa
atctgttactactttgaagccctggcgcagctatctgccgcgcagcgcaataatttagtt
gtttctgtacccagtggtaattttggcgatttaactgcgggtttgctcgctaaatcttta
gggttgccgattaaacgttttatcgcagcgaccaatgaaaatgatacggttccccgttac
ctggaggaaggaacttggacgcctaaagcgacggttgctacgatttcaaatgcgatggat
gtcagtcagcccaataattggccacgtattgaagaattatttaaaatacaaggttggtca
ctatcagaacttgggtacggcatgttaaacgatgcacaaacgcgtgccagtctgcttgaa
ttggataatttaggttacttatgtgaacctcatggcgcaattgcttacgctgaacttact
aaacaattaaaagaagatgaaacaggtttattcttgtgtacagcgcatcctgctaagttt
aaagaaagcgtagaagatattttagggcgtgatattttcattccggaagagcttgcttct
cgtgcgaatttagatttattatcaaaagaatttcctgctgattttgcaatggttagagca
ctattgatgtctttgtaa

DBGET integrated database retrieval system