KEGG   Psychromonas ingrahamii: Ping_1428Help
Entry
Ping_1428         CDS       T00450                                 

Definition
(GenBank) nitrous oxide reductase apoprotein
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00910  Nitrogen metabolism
pin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Ping_1428
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Ping_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cu-oxidase_3 Cupredoxin_1
Motif
Other DBs
NCBI-ProteinID: ABM03245
JGI: Ping1428
UniProt: A1SUT0
Position
complement(1753879..1755771)
Genome map
AA seq 630 aa AA seqDB search
MSKYKSDLPNDEKLENSDRRKFFGKSAAFGVAAAAVPMSAVMFSSMAKAQAAEASNSTAV
HPGDLDEYYGFWSGGQSGEVRIMGIPSMRELMRIPVFNLDSATGWGLTNESKRIKGDSAH
FMTGDAHHPHMSMTDGRYNGEYLFINDKANSRVARIRCDVMKTDKMITIPNVQGVHGLRV
QKVPETKYVICNGEFEIPMNNDGKASLEDVSTYRSLFSVINAQTMEIAFQVMVDGNLDNT
DADYDGKYFASTCYNSEMGMTLGAMITAERDHVVVFSLARCEAAVKAGKFKTYNSNNVPV
LDGRKGSKLTRYIPVPKSPHGVNTSPSGKYFIANGKLSPTVSIISIEKLDALFDDKIKPR
DTVVAEPELGLGPLHTAFDNKGNAYTTLFIDSQIAKWNIEDAIKAHNGEKVKYLRQKLDV
HYQPGHNHTSMGETRDADGKWLVVLSKFSKDRFLPVGPLHPENDQLVDISGDEMKLVHDG
PAFAEPHDCILVHRSKIRTAKLWTRDDRMFAETVAMAKKDGVNVDTDNKVIRDGNKVRVY
MTSVAPMYGMTEFKVKLGDEVTVVVTNLDMVEDVTHGFCMINHGVQMEIGPQATSSVTFT
ASQPGVQWYYCNWFCHALHMEMRGRMLVEA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtataaaagcgatctacccaacgatgaaaaactggaaaattcagaccgacgt
aaattttttggtaaaagtgcggcctttggcgtagcggcagctgccgtgccaatgtcagcg
gtcatgttttcctctatggcaaaagcgcaggcggctgaggcaagcaatagcaccgccgtc
catcctggtgatttagatgaatattatggcttctggagtggcggtcagtcaggcgaagtc
cgtattatgggtattccttcaatgcgtgaattaatgcgtattccggtttttaatttggac
agtgcaacgggttggggattaactaacgaaagtaaacgtattaaaggcgacagtgcccat
tttatgaccggggatgcacatcatccgcacatgagtatgaccgatggtcgttataacggt
gagtatctttttattaacgacaaagctaactcacgtgttgcacgtattcgttgcgatgtc
atgaaaaccgataaaatgatcactattcctaacgtacaaggggtccatggtttacgtgtt
cagaaagtacctgaaactaaatatgtgatttgtaatggtgagtttgaaattccaatgaat
aatgacggtaaagcgtcactggaagatgtcagtacttatcgttcattatttagtgtgatt
aacgcgcaaacaatggaaattgcttttcaggtgatggtcgacgggaacttggataatacc
gatgccgattacgacggcaaatattttgcatctacttgttataactcagaaatgggcatg
accttaggggccatgatcacagcagaacgtgaccatgtggtggtctttagtttagcgcgt
tgtgaagccgccgttaaagcgggtaaattcaaaacttataacagtaataatgtccctgta
ttagacggccgtaaaggatcaaaacttacccgttatattccagtccctaaatcaccccat
ggtgttaatacctcaccttctggcaaatattttattgctaacggcaagttgtctcccaca
gtttctattatttcgattgagaaattagatgccttatttgatgataaaattaaaccacgc
gatacagtagttgcagagcctgaattaggtttagggccactgcatactgcctttgataac
aaaggaaatgcttataccactctgtttattgacagccagatagccaaatggaatattgaa
gatgcgatcaaagcgcataatggtgaaaaagtgaaatatcttcgccagaaactggatgta
cattatcaacccggtcataaccatacttctatgggtgaaactcgtgatgcagacggcaaa
tggttagtggtactgagtaaattctctaaagatagatttttacctgttggtccgttacat
ccagaaaacgatcagttagttgatatttccggtgacgaaatgaaactggtccatgacggc
cccgcttttgctgaaccccatgattgtattttggttcaccgcagtaaaataagaacagca
aaattatggacacgtgatgaccgcatgtttgctgaaaccgttgccatggctaaaaaagat
ggcgttaatgttgataccgacaataaagtcattcgtgatggtaataaagtgcgagtatac
atgacctccgttgcgcctatgtatggcatgactgaatttaaagtgaagcttggagatgaa
gtgaccgtcgtggtgactaacctcgacatggtagaagatgttacccatggtttctgtatg
attaaccacggtgtgcagatggagattggcccgcaggcaacctcatctgttacttttacc
gcaagccaacctggtgtgcagtggtattactgtaactggttctgtcatgcattacatatg
gaaatgcgcggtcgtatgttagtcgaagcataa

DBGET integrated database retrieval system