KEGG   Psychromonas ingrahamii: Ping_1460Help
Entry
Ping_1460         CDS       T00450                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pin  Psychromonas ingrahamii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1803951..1806047
Genome map
AA seq 698 aa AA seqDB search
MLTQLKQWKEQGLLRSIDYHFAAFMAEMGADKLTQLSAAFCSEYLGLGHICLPVEEIIIR
LNDKCSLSELDLQGFCREHDMECLLQNNFEAHALLSSSICVGDNAPLCLQFNALYLTRYA
LFEQLIADKLLDQPKLSLGSDIKVELDVLFATNYTYLWQDWCRDPRQPLPLLCEKYIDLL
PGSTVDWVGVEQLFSQAENAQDLQPLGSLIPENKRCNWQKVSAALALTTARCVISGGPGT
GKTTTVTKLLALLLKFQPTLLIKLVAPTGKAAARLTESITHALVELNIEPGIKDKMPKVA
TTIHRLLGVKANSNHFRFNQDEKLNVDLLVVDEASMVDLPLMAKLLMALPDHARLILLGD
KDQLASVEAGAVLGDICHFIESGYSAKKAQLLADLTGYTSLTKTAPRSPNMADNLCLLRK
SYRFDQYSGIGYLAKAINSGRANSKKVMALCDDYNDLQHYPNTELGKKELAALVLEGYRP
YLQNLSTITVDNRNLAGQLLKQFNQFKILCATREGEWGVKCLNKLCETVLEKAGLLTTGQ
VHKDPQHAYVYWYVGRPVMITQNNYHLGLYNGDIGLCLLDESLQLRVYFQMPDASIADFQ
PSRLPNHETVFAMTVHKSQGSEFEHTVLALPENHVSVVSRELIYTAITRAKKQLTLFADL
SLMASAMRHKTKRFSRLVERLKSPSVTLAEKVKQKIKE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgttaacacaactaaaacaatggaaagagcaggggctattacgttcaattgattaccat
tttgcagcctttatggcggaaatgggggcggataaattaacccagttaagtgctgccttc
tgcagtgaatatctgggtcttgggcatatctgtttacccgttgaagaaatcattatccgt
ttaaatgataaatgttcgttaagtgaacttgatttgcaggggttttgccgggaacatgat
atggaatgtttattgcagaataattttgaggcacatgcgttattaagtagttcaatctgt
gtgggtgataatgcccccctgtgtttacagtttaatgccttgtatcttacccgttacgcc
ctgtttgagcagcttatcgctgataaattattggatcaacctaagttgtccttgggttct
gatatcaaggtggaactcgatgttttatttgccaccaattatacctatttatggcaggat
tggtgccgcgatccaagacaacccctgcctttattatgtgaaaaatatattgatcttctc
cctggatcgacagttgactgggtaggagttgaacagttatttagtcaggccgaaaatgcg
caggatttacaacccttaggatccttgattccggaaaataaacgctgtaactggcaaaag
gtcagtgctgcattagccttgactactgcgcgatgtgttatctcaggagggcccggcacg
ggtaaaactacgactgttactaaactgctcgccttgctgctgaaatttcaaccaacactg
ttgattaaattggttgctccaacgggaaaagctgctgcgcgtttaacagaatctattacc
catgccttagtggaattaaacattgagccgggcattaaagacaaaatgcccaaggtggcg
acgaccattcaccgcttgttgggggtaaaagccaacagtaatcactttcgttttaaccag
gatgaaaaattaaatgtcgatctgctggtggtggatgaagcttcgatggtcgatttgccg
ctgatggcaaaattattaatggcgctaccggatcatgcccgcctgatattattaggtgat
aaagaccagctggcatcggttgaagcgggagctgttttaggggatatttgccattttatt
gaatcgggatacagtgctaaaaaagcgcagctgttggcagatttaacgggttatacctcg
ttaaccaagaccgcccctcggtcacctaatatggctgataatttatgtttgctgcgtaaa
agttaccgttttgaccaatactcggggattggctatttagccaaggcgattaatagcggc
cgcgcaaacagcaaaaaggtgatggcgttatgtgatgattataatgatttgcagcactat
ccgaatactgagttgggtaaaaaagagttggcagctctggtcttggaaggttatcgtccc
tatttacaaaacctgtcgactattaccgtagacaatcgaaaccttgcggggcaactatta
aagcagtttaaccaatttaaaatattatgtgcgacgcgcgaaggggagtggggagtcaag
tgtttaaataaactctgcgaaacggtattagaaaaagcaggcctgttaacgaccgggcaa
gtgcacaaggatccgcaacatgcctatgtttattggtatgtcggtcgtccggttatgata
acccaaaacaattatcatttaggtttatataatggtgatattggcctgtgtttattagat
gaatctttacagttacgtgtttatttccaaatgcccgatgcgtctattgccgattttcag
ccaagtcgtttgcccaaccatgaaactgtttttgccatgacggtacataaaagccaggga
tctgagtttgagcacactgtattagcattacctgaaaatcacgtctctgtggtcagccga
gaactcatttataccgctattacccgcgcaaaaaaacagttgacgctgtttgccgattta
tccttaatggccagtgcgatgcgccataaaacaaaacgttttagccgtttagttgagcgt
ttaaaaagcccatccgtaacccttgcagaaaaagttaaacagaaaataaaagaataa

DBGET integrated database retrieval system