KEGG   Psychromonas ingrahamii: Ping_1475Help
Entry
Ping_1475         CDS       T00450                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00220  Arginine biosynthesis
pin00250  Alanine, aspartate and glutamate metabolism
pin00290  Valine, leucine and isoleucine biosynthesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01130  Biosynthesis of antibiotics
pin01210  2-Oxocarboxylic acid metabolism
pin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ping_1475
   00290 Valine, leucine and isoleucine biosynthesis
    Ping_1475
   00220 Arginine biosynthesis
    Ping_1475
Enzymes [BR:pin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Ping_1475
    2.6.1.66  valine---pyruvate transaminase
     Ping_1475
Amino acid related enzymes [BR:pin01007]
 Aminotransferase (transaminase)
  Class I
   Ping_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABM03292
JGI: Ping1475
UniProt: A1SUX7
Position
complement(1823709..1824923)
Genome map
AA seq 404 aa AA seqDB search
MYTIQKSTKLDNVCYDIRGPVLKQAHKLEEEGQRILKLNIGNPAQFGFDAPEEVMMDVIK
NLPQSQGYCDSKGLFSARKSVMQHYQAKGLLSLDTHDIYIGNGVSELIVMAMQGLLNNGD
ELLVPAPDYPLWTAATNLSGGKAVHYICDEQSDWFPDIEDIKSKITVKTKGIVIINPNNP
TGAVYSRELLEQIIELARIHNLIVFSDEIYSKIIYDDAVHIPLATLADDILIVTFDGLSK
AYRVCGFRVGWMMISGAKKQARDYINGLEMLASMRLCANVPMQHAIQTSLGGYQSINELT
VPGGRLYEQTQSAWKLINDIPGLSCTKPKGALYLFPKLDQKKFNIKDDQRFAMDLLMEEK
ILIVQGTGFNWHSPDHFRIVCLPRVDELSTAISKIGRFLQSYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtataccattcaaaagtccactaaattagataatgtctgttatgacattcgcggaccc
gtccttaaacaagcgcataaattggaggaagaaggacagcgtattttaaaactaaatatc
ggtaatcctgcccaatttggctttgatgcacctgaagaagtgatgatggatgtgataaaa
aacctgccgcaaagtcaggggtattgtgacagcaaaggccttttttccgcccgtaaatcg
gttatgcagcattatcaggcgaaaggtttactgtcacttgatacccatgatatttatatt
ggcaacggagtcagtgaattaattgtaatggcgatgcagggtttattaaataatggtgat
gagctattggtacctgcaccggattacccgctatggacagccgcaacaaatttatccggc
gggaaagcggtccattatatttgtgatgaacagtcagattggtttcccgatatcgaggat
attaaatctaaaataaccgtcaaaaccaaagggattgttattatcaatcccaataatccc
accggcgcggtttacagcagggagttattagagcagattatagagcttgcccgtatccac
aatttaattgtcttttccgacgaaatctattcgaaaataatttacgatgatgcggtgcat
attccactcgcaaccctcgctgacgatattttaattgtgacctttgatggactatctaaa
gcctatcgggtttgcggttttcgcgtcggttggatgatgataagcggcgcaaaaaagcaa
gcgcgtgattatattaatggattagagatgctcgccagtatgcgtttatgcgccaatgtg
ccgatgcagcatgctatccaaacttcccttggcgggtatcaaagtattaatgagttaacc
gtcccaggcggacgtttatatgaacaaactcaaagtgcatggaagttaattaatgatatt
cccgggttaagctgtactaaacctaagggcgctttataccttttccctaaactggatcaa
aagaaatttaacattaaagacgatcagcggtttgccatggatctgttgatggaagaaaaa
atattaattgtacaggggacgggctttaactggcactcaccggatcacttccgtattgtt
tgtttgccgcgtgttgatgaactcagtactgctatctcgaaaataggccgttttctgcaa
agttatcgccagtag

DBGET integrated database retrieval system