KEGG   Psychromonas ingrahamii: Ping_1494Help
Entry
Ping_1494         CDS       T00450                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pin  Psychromonas ingrahamii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ping_1494
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ping_1494
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ping_1494
Lipid biosynthesis proteins [BR:pin01004]
 Desaturase
  First
   Ping_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1841378..1842496
Genome map
AA seq 372 aa AA seqDB search
MNKPRILWLNVLFFLSTFLLAAIAVPYRAITHGFDASEIMFALLCFIFCGMSITAGYHRL
WSHKTYQAHWSLRFIFALGGAFALQNSILHWSSDHRIHHKHVDNNDKDPYSAKMGFWYSH
LGWMLREYHPTTYDDYNNVRDLQKDPIVIWQHKYYLLLTLLLNIGIPLFFGFWHGDIINS
ILLVGFLRLVLSHHTTFFINSLAHIWGKQTYSDKNSARDNGFLAFLTFGEGYHNFHHIFE
NDYRNGIRWWQFDPTKWLIKSCEYLGLTSKLRISPEDRLEKAKLAMTLKRSQQKLATYPN
PEKMLERLQSEYDLLIVKINEYYAVHKQLLSERKKELVNDVENSELIKTCLELKKCVAEQ
QRSWKLLTAKFV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccccgtattctttggcttaatgttttgttctttttgagcacttttttatta
gccgcaattgccgtaccttaccgtgctatcacgcatggttttgatgcgtccgaaattatg
tttgcactcttatgttttattttctgtggcatgtccattacggcaggctatcatagattg
tggtcacacaaaacttatcaggcacattggagtttacgttttatttttgccttaggcggt
gcattcgctttacaaaacagcatattgcattggtcatcggatcatcgaattcatcataag
catgttgataataatgataaagatccctattccgctaaaatgggattttggtattcacac
cttggctggatgctgcgtgaatatcatccaactacttatgacgactataataacgtgcga
gatttgcaaaaagatcctatcgtaatatggcagcataagtattatttgttgttaacactg
ctgctaaatattggcataccgttattttttggtttttggcatggtgatatcattaacagc
atcctattagtggggtttttacgtttagtgttaagtcaccataccactttctttatcaac
tcattagcgcatatctgggggaaacaaacctatagcgataaaaacagtgcaagggataat
ggttttttggcctttcttacctttggtgagggctaccataactttcaccatatttttgaa
aatgattatcggaatggtatccgttggtggcaatttgatccgactaaatggttgataaaa
agttgtgaatatctggggctgaccagtaaattacgcatcagtcctgaagatcggttggaa
aaagctaaattagccatgaccttaaagcgcagtcaacaaaaattagcaacataccctaat
ccggaaaaaatgcttgaacgtttacaatccgaatatgatctgcttattgttaaaataaat
gagtattatgccgtacataaacaattgttgtcagaaagaaaaaaagaacttgtgaatgat
gttgaaaattcagagttaataaaaacctgtctggaattaaaaaaatgtgtagcagagcag
caacgcagttggaaattattaaccgctaaatttgtttaa

DBGET integrated database retrieval system