KEGG   Psychromonas ingrahamii: Ping_1729Help
Entry
Ping_1729         CDS       T00450                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pin  Psychromonas ingrahamii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pin00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2104362..2105009
Genome map
AA seq 215 aa AA seqDB search
MIKINKSNTASFDVDPQRGFTSLCPNELPISEGEQIADQLNAQAQFAAYRLVSKDCHPAE
APWIANSTDEVMTPVAGDYPNLDIKWPAHCVVGTEGNQLIPGLPDEADYDLLVTKGTDPF
KHPYGACYQDLGESESTGAIEWLHKRQIKVVIVGGLATDYCVKITVLQLCLAGFKVIVNL
GACRGVASETTKSACAAMSAAGAELIQGSGEMELQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattaataaatccaacaccgccagctttgatgtcgatccgcagcgcggtttc
acgtcattgtgtcccaacgagctacctattagtgagggggagcagattgctgatcagtta
aacgcccaagcacagtttgcagcttatcgtctggtcagtaaggattgtcaccctgccgaa
gcgccttggattgccaactcgaccgatgaggtaatgacacccgttgctggagattatcct
aatttggatatcaagtggccggcgcactgcgtggttggcactgaagggaatcagcttatt
ccgggactgccggacgaggcagactatgatctgctggttacaaagggcactgatccgttt
aaacacccctatggcgcttgctatcaggatcttggcgaaagtgaaagcactggagcgatt
gaatggttgcataaacggcagataaaagttgttattgtcgggggactggcaaccgattat
tgtgtcaaaatcactgtactgcaactttgtctagccggatttaaagtgatcgttaatctt
ggcgcttgccggggagttgccagcgagaccactaaaagtgcctgtgcggcaatgtctgct
gccggggctgaactgattcaaggcagtggggaaatggagttgcaatga

DBGET integrated database retrieval system