KEGG   Psychromonas ingrahamii: Ping_1840Help
Entry
Ping_1840         CDS       T00450                                 

Definition
CheR-type MCP methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pin  Psychromonas ingrahamii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pin02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pin02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2233264..2235786)
Genome map
AA seq 840 aa AA seqDB search
MINTPVIVGIGASAGGFEALEEFFSHVLTPCNIAFVVIQHLDPTHKGIMPELLQRDTTMK
VKQACNNMKVKPNCVYVIPPDKDLSVLHGVLFLLEPVVKHTIRLPIDSFFQSLAADQHER
AVGVILSGMGSDGTLGLRAIKENAGLSLVQSPESAKFDSMPQSAINAGLADITAPAEELP
ERIIAFLEHSRRGVPNKLEPIVKRKSTSALAQIIMILRERSGNDFSLYKTNTIDRRIKRR
MGLHQLETISLYARYLRDNSQEQDLLFKELLIGVTNFFRDKDVWAQLKSTSLPALLANYP
EGKELRAWVTACSSGEEAYSLAMTVMDVLDEIKPKGHFKLQIFATDLNQDAINIARKGYY
PAGIEADMSAQQLDRYFIKDGSGYRINKNIRDMVIFAPQNIIMDPPFTRLDILTCRNLLI
YLAPELQKKLLPLFHYTLTSHGLLILGNSETIGNATSLFSEIKENTRIYTRIDRPGQHTE
VDFPTKIFPIMPLAENEHEGTRKMTKNISNLQTQADQILLQNYSPAAVLVNAAGDIIYIN
GRTGKYLEPAAGKANWNIHVMAREELQHQLELAIKKAQMQVEPVTIENITVDTHSVNLTV
QAIIKPKDLLGLIMVVFTEVVTPTRRRRKKQGAAEQESQAELQLAHDEIKSLREQMQSTH
EELKSANEELQSTNEELQSTNEELTTSKEEMQSMNEELQTVNTELQSNVDDLSWVNNDME
NLLNSTEIATIFLDNGLHIRRFTNHATHVFKLIEGDKGRPLFDIVTDLDYKDLQKDAKKV
LKTLAFVEKEIAANNERWFKVRIMPYRTQENVIDGVVITFTNISEAKLLESELRKTRSNP
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatacccccgttattgtcggcataggggcttctgctggcggctttgaagcattg
gaagaatttttctctcatgtgctaacgccttgtaatatcgcatttgttgttatccagcac
cttgaccccactcacaaagggatcatgcctgagctgttgcagcgcgacacgacgatgaaa
gtaaaacaagcttgcaacaatatgaaggtaaagcccaactgtgtgtatgtgatcccacct
gacaaagatttatcagttcttcacggggtattatttctgttagaaccggtggttaagcac
acgatccggttacccattgattcattctttcaatctttggccgctgatcagcatgaacgc
gctgtgggtgttattttgtcaggcatgggatccgatggcacgcttggtttacgcgccatc
aaagaaaatgccggactgtctctggtacagtcgcctgagtcagctaaatttgattcaatg
cctcaaagtgctattaatgccgggctagctgacatcacagcccctgctgaagaactaccg
gaacggattatagcgtttctcgaacatagccgacggggtgttccaaacaaacttgaaccg
atagtgaaacgcaagtcaacaagcgcactagcgcagatcattatgatactgcgtgaacgc
agtggaaacgacttctcactgtacaagacaaataccatagatcgtcgtattaaacggcgt
atgggtctgcatcagcttgaaaccatctcgctctatgcccgttatctacgtgataattcg
caagaacaagacctgttattcaaggagctgttaattggggtaaccaatttctttcgtgat
aaagacgtttgggcgcagctcaagtcaacctcactgccagcactattagctaattatcct
gaaggtaaagaactgcgggcatgggtaaccgcttgctcatctggtgaggaggcttactct
ctcgcaatgacggtaatggatgtattggatgaaattaagcccaaagggcatttcaaatta
caaatttttgcgaccgatcttaatcaggatgccatcaatattgcaaggaaaggctattat
ccggcaggcattgaggctgacatgtccgcacagcaattggatcgttatttcattaaagat
ggcagtggttaccgcataaacaagaacattcgtgacatggtgatcttcgcaccacagaat
atcattatggatccccctttcactcgattagatattctcacctgtcgtaatcttctgatt
tatcttgcaccggaattacaaaaaaagttactgccactgttccactacacattaacttct
catgggcttttgattctgggcaattccgaaacgattggtaatgccacctcattgttctca
gaaatcaaagaaaacacacggatttacacgcgcattgacaggcctggacagcacacggaa
gtcgactttcctactaagatatttccgattatgcccctggcagaaaatgaacatgaggga
acccgtaagatgaccaaaaatattagcaatctacaaacgcaggcagatcaaattctgttg
caaaactattcgccagcagcggtgttagtcaatgcggcaggcgacattatctacatcaat
ggtcgtaccggaaaatatttagagcctgctgcgggcaaagccaactggaacattcacgta
atggcacgtgaagaactacaacatcagcttgagctcgctatcaagaaagcacagatgcag
gtagagccagtgacgattgaaaatatcacagtagatacacacagtgtcaatttgacggta
caagcgattattaagccaaaagatttgcttggcttaataatggtggtgtttactgaagtt
gtgacgccgaccaggcggcgacgcaaaaaacagggggcagcggagcaagaaagtcaggcc
gaactacaactggcgcatgatgaaataaaatccctccgcgaacaaatgcaatccactcat
gaggaactaaagtctgccaatgaggagttgcaatcaacgaatgaggagttgcaatccacc
aatgaagaattgaccacctctaaagaggagatgcagtcaatgaatgaagagttgcaaacc
gtcaacaccgaactgcaatccaacgttgatgatttgtcatgggtcaacaatgacatggag
aacctgcttaacagtacagaaattgctaccatttttctggataacggactgcatatacgg
cgcttcaccaaccatgccactcatgtattcaagctgattgaaggtgataagggccgacca
ctgttcgacattgtcacggatctggattataaagatctgcaaaaagatgctaagaaggtg
ttaaaaacgctggccttcgtagaaaaagagatagcggctaacaatgaacgctggttcaaa
gtccggatcatgccttatcgtacccaagaaaatgtcattgacggtgtggtgataaccttc
accaatattagtgaagccaaactgcttgagtcagaattacgcaagacgaggtccaaccca
tga

DBGET integrated database retrieval system