KEGG   Psychromonas ingrahamii: Ping_1955Help
Entry
Ping_1955         CDS       T00450                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ping_1955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_1955
  Lipid metabolism
   00071 Fatty acid degradation
    Ping_1955
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ping_1955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ping_1955
   00626 Naphthalene degradation
    Ping_1955
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ping_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2377614..2378696)
Genome map
AA seq 360 aa AA seqDB search
MSPSSMKASMTAIVTTGSGGYDQLVCKQVPIPDLCNGEVLVKVLAAGVNNTEINTRLGWY
SSSVHGSTNDTSNSEKDQPKADGGWNKQTAFPFIQGTDCCGVVVNVADDVDTGLMDKRVL
IRPCIREHGFGSLDNIWMGSDFDGAFAEYVKIRATEVFPVVCNWSDAELGTIPCAYGTSE
NMLNRANLRAGETVLVAGASGGVGSATVQLAKRRGAKVIAIAGEEKHDKVAPLGADILLG
RSANLLVELGEQSVDVVVDNVGGSGFPTMLKLLKRGGRFVSSGAIAGPIVELDMRDMYLK
DITLIGTTAWEKTVFPDLVRYIEQGEIHPVLAKTFPLSSIAEAQKEFLEKKHVGKFVLIP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctagttcaatgaaagcttcaatgacagccatagtcaccacaggcagtggcggt
tatgaccaattggtctgcaaacaagttccaattccagatctctgcaatggagaagtgctg
gttaaagtgttggccgccggcgttaacaatactgagattaataccagactgggatggtat
tcttcttcagtgcacggctctaccaacgacacctcgaactcagagaaagatcagccaaag
gccgacggcggctggaataagcaaacggcttttccatttattcaaggcacagattgctgt
ggggtggtggtgaatgtggcagacgatgtcgatactggtcttatggacaaacgggtactt
atccggccctgtattcgcgaacacggttttggctctttggataatatctggatgggatct
gattttgatggtgcttttgctgaatatgtgaaaattcgagcaactgaagtgttcccagtg
gtctgtaactggagcgatgcagaacttggtactattccttgtgcctatggtacatccgag
aatatgctcaacagggccaatttgagagccggtgaaacggttttggtagcgggtgcatca
ggtggagtaggctctgctactgtacagcttgcaaagcgcaggggagccaaggttatcgcc
attgcgggagaggaaaagcatgacaaagtagctccgcttggcgcagatattctgttaggc
agaagcgctaatctgcttgtggaattaggggagcaatctgtcgatgttgtggttgataat
gtgggcggaagtggttttccgaccatgctcaaactattaaaacgaggtgggcggtttgtc
tcatccggcgcgattgcagggcctattgttgaacttgatatgcgcgatatgtacctgaaa
gacatcacgctaataggtacaaccgcttgggagaaaactgttttccctgatcttgtgcgc
tacatagagcagggcgaaattcaccccgtgttagcgaagacctttccgttatcttcgatt
gccgaagctcaaaaagagtttcttgagaaaaagcacgtcggtaaatttgtactgataccc
taa

DBGET integrated database retrieval system