KEGG   Psychromonas ingrahamii: Ping_2014Help
Entry
Ping_2014         CDS       T00450                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pin  Psychromonas ingrahamii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pin00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pin00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pin00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2450553..2452655
Genome map
AA seq 700 aa AA seqDB search
MKNIIHLTSKNCSLIIKVETTPEILHWGPKINQIDPDILLATERPIPQARLDVDVPLSLC
PELGSGHFNAPGLEGHRESFDWAPVFEVFDQDLAAQSVVFKLQDKVAKLQLEIEIKLDFE
SDVIQKRIKVINTGETKYSLTKLSSTLPLPNHANELMSFHGRWSREFQTHRQRFAHGGFM
QENRRGRTSHENFPGLFVGSDHFNEQNGQVWGFHLGWSGNHQLRADVRSDGRRFVQAGEL
LLSGEVVLGALESYSTPWLYATYSAAGLNGISEHFHRFVRDNIIKFPEDKPRPVHLNTWE
GIYFEHDPQYIMKMANEAAVMGVERFIIDDGWFIGRHGERAALGDWYLDKEKYPNGLEPV
IKHVNDLDMEFGLWVEPEMVSEESMLYRAHPDWVLALQGYHQPSGRWQYVLDLQNTACFN
YLFERLNDLLTRYNISYLKWDMNRELVQPGHQGKPAVSGQTNALYALLDKLLAVHTEVEI
ESCSSGGGRIDFEILKRTHRFWPSDCNDALERQTIQRGMSYFFPPEVMGTHIGPEESHTT
RRVHHINMRGMTALSGHMGVELDPVKVPVEERQAFAKYIALHKQYRHLLHSGRSFRVDTA
DNSQNIYGVHNNDEMLITVCQLTMPDYALPSPLRISCIDTTAQYQVNLVETPENSFQLMK
QRPKWLDKTLTLSGESLKEIGLSLPILDPESALMLHLKKR
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcattcatcttaccagcaaaaactgcagcttgatcatcaaggttgaaact
acccctgaaattcttcattgggggccaaaaataaatcagattgatcccgatattctgctc
gctaccgagcggcctattccccaagcgcgccttgatgttgatgtgccgctttctttatgt
cctgagttaggcagtggtcattttaatgcacccggtctggaaggtcatcgtgaaagtttt
gattgggcccctgtttttgaagtatttgatcaggatttggcagcgcagtctgtcgtcttt
aaactgcaggataaggttgccaaactgcagttagagattgaaataaaactggattttgaa
agtgatgttatccaaaaacgtattaaagttattaacaccggtgagactaaatattcttta
accaagctttcttctaccctgcccctgccaaaccatgctaatgaactgatgtctttccac
ggtcgttggagtcgtgaattccaaacccatcgtcaacgtttcgcgcacggtggttttatg
caggaaaaccgtcgtggtcgaacttctcacgaaaattttcctggtctatttgtcggcagc
gatcattttaatgaacaaaatggtcaagtttggggctttcatttaggttggagtggtaac
catcaactgcgtgcggatgtaagaagtgacggtcgccgttttgtgcaggcgggtgaatta
ttactctctggagaagttgttttaggggcattagaaagttatagcaccccctggttatac
gcaacttacagtgcagcgggtcttaacggtatttctgagcacttccaccgttttgtgcgt
gataatattattaaattcccagaggataaaccccgtccggtgcacctgaatacctgggaa
ggtatctatttcgagcatgatccacaatacattatgaagatggcgaatgaagccgctgta
atgggtgttgaacgctttattattgatgatggctggtttattgggcgacatggggaacgt
gcggcactcggtgattggtaccttgataaggaaaaatatccaaatggtttagagcccgtt
attaaacacgtcaacgatctggatatggagtttggtttgtgggttgagccggaaatggtc
agcgaggaatcaatgctgtaccgcgctcatccggattgggttttagcgttacagggttac
catcaaccttctggtcgctggcaatatgtgctggatttacaaaatacagcatgtttcaac
tacctgtttgaacgcttaaacgatctcttaacacgttacaatatctcttacctaaaatgg
gatatgaaccgtgagttagtacaacctggacatcagggtaaaccggcggtcagtgggcag
actaacgccttatacgcgttgcttgataaattattagcggtccacacggaagttgaaatt
gaatcctgttcatcgggtggcggacgcattgactttgaaattctcaaacgtactcatcgt
ttctggccatcggattgtaatgatgcgttagagcgtcaaactatccaacgcggcatgagc
tacttcttcccaccggaagtgatgggcacccatatcggcccggaagaaagtcatacaaca
cgccgtgttcatcatatcaatatgcgcggtatgacagcattaagcgggcacatgggagtg
gaattggatcctgttaaagtgccggtagaggaaagacaagcctttgctaaatatattgca
ctgcataaacaataccgtcacttattacatagcggtcgcagtttccgtgtcgatactgca
gataatagtcaaaatatttatggcgtccataataacgatgaaatgctaatcaccgtctgt
caattaaccatgcccgattatgcactgccgtcaccactgcgcattagctgcatcgacaca
acggctcaatatcaagttaacttagttgagacccctgaaaacagcttccaattaatgaag
caacgccctaaatggttagataaaacccttactttaagcggtgaaagcctgaaagaaatc
gggctgagcttgcctattcttgatccggaatcagcgcttatgctgcacttgaaaaaacga
taa

DBGET integrated database retrieval system