KEGG   Psychromonas ingrahamii: Ping_2018Help
Entry
Ping_2018         CDS       T00450                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00052  Galactose metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
Module
pin_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2018
   00052 Galactose metabolism
    Ping_2018
Enzymes [BR:pin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Ping_2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABM03782
JGI: Ping2018
UniProt: A1SWB7
Position
2456322..2457395
Genome map
AA seq 357 aa AA seqDB search
MTLSRAEQLQKSMSIDPAFDGQPAKIFVLKNRLGMCITLMDIGATWLSCEIPVGDQMRDV
ILGVTTMNDHLRQKAYLGATIGRFANRLSGGQFKIAGQHYQVDKNQGNNTLHGGVTGFDK
CRWHAQQLNNQCVTFTLLSKDGDQGFPGNLDVKVTYHLSDDNELSIDYWAVTDKACPVSL
TNHAYFNLMGESGQCCLQHQLFIAAEHYLPVNNTGIPIGHIKPVAGSRFDFSALKEISQD
FLSCQDQKIVGGYDHSFLINKAHQDGSKVAAKCVSPDKKVTLEIKTTQPALQLYTGNYLG
GTPNRSGGTYKNRSALALETQFLPDAPNHPEWDQPSSILLPGEVYAHQTSYRFTVAD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaagtcgagcagaacagttacagaaaagcatgagtattgatcccgcttttgat
ggtcaacccgctaaaatttttgttttaaaaaacaggctgggtatgtgtatcacactgatg
gatattggtgcgacttggttaagctgtgaaattcctgttggcgatcaaatgcgcgacgtc
attcttggcgtcacgactatgaatgatcatttacgtcagaaagcttatcttggcgcaacg
attggccgctttgcaaaccgacttagcggcggacaatttaagattgccgggcaacattat
caagttgataaaaatcaagggaataataccctgcacggtggcgtgacaggttttgataag
tgccgctggcacgcacagcagctcaataatcagtgcgttacttttacactcttatccaaa
gatggcgaccagggtttcccaggcaatttagacgttaaagtcacctaccacttaagcgat
gacaatgaactgtccattgattattgggcagtgacggataaagcgtgtcccgtgagcctg
accaatcatgcttattttaatttgatgggcgagtccgggcaatgctgtttacagcatcag
ttgtttattgccgccgaacactatctgccggtgaataatacgggcattcctatcgggcat
ataaaacctgttgcgggcagtcgttttgattttagcgcgctgaaagaaatcagtcaggac
ttcttaagttgccaggatcagaagatagtcggcggttatgatcattcatttttaatcaac
aaggcgcatcaggatggcagcaaagtggcggctaaatgtgtttcaccggataaaaaagtg
acccttgaaataaaaaccacgcaacctgctctgcagctttatacgggaaattatttaggc
gggaccccgaaccgttctggggggacctataaaaaccggtcagcattggcgctggaaacg
caatttttacccgacgcacccaatcaccctgaatgggatcagcccagctcaatattattg
cctggtgaggtatacgcccatcaaacatcttatcgctttactgttgccgattaa

DBGET integrated database retrieval system