KEGG   Psychromonas ingrahamii: Ping_2019Help
Entry
Ping_2019         CDS       T00450                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pin  Psychromonas ingrahamii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pin00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pin00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pin00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2457541..2460648
Genome map
AA seq 1035 aa AA seqDB search
MREFSEIIKARDWENQEVTHQHVVQAHAPLHAFHSKQAALDNQASEFQQLLNGQWRFQLF
AKPEAVPNHCINIDFDDSAWSDITVPSNWQLQGYDKPIYTNVKYPFADNPPFVPADNPTG
VYRLNFTLPTAWKERKNTVIFDGVNSAFHLWCNGIWVGYSQDSRLPAEFDLSCHLQAGDN
QLTVMVLRWSDGSYLEDQDMWWLSGIFRDVCLLSKPLISIRDITVSTELDACFNHGSINV
VTQLSEQSSQYTAQVQLFDAQLQPVTKLVGAPFGERMIDEKGPANDRAEHKIAVPSPHKW
SSESPYLYRVVISLVDNEGQVVDSEAYQVGFRVVEMSNGQLKLNGEALLIRGVNRHEHHP
EKGHAISYEDMLVDIKLLKQNNFNAVRTAHYPNHPLWYELCDQYGLYVVDEANLETHGQF
PMSRLSNDLSWLNAYMRRMTRMVERDKNHPSIIIWSLGNESGLGHHHHAMYQWTKRRDPT
RPVQYEGGGADTAATDIIVPMYARVNKDITLPNAPDVVPKMAIKKWLSMPNEQRPLILCE
YAHAMGNSLGSFDKYWQAFREYPRLQGGFIWDWVDQGLTKIDDNGDNYWAYGGDFGDQIN
DRQFCINGLVFPDRSLHPTVYEAKKAQQFYQFSLVDGDQLKVKIDSENLFIESMDETLCW
SVTEAGYVIASGEMELHVTAQSSKILTLLESYPEQKIGCDYFLNIEIVLNKDKPWATKGF
VVATEQVALASIAQLTNVPLIESGAPRLSEDKNKITVAGTGSGAEFELEIDKQQGVISQW
LVRGENKILQGPKDNFFRAPLDNDIGTSEADCIDPNAWVTQWDTAGIANLVPHCIAIEAV
TLARSVLVKVEFGHYVENKLLISSHWQYTINNQGEVQIDVNVNLAKSLSPLPRIGLELIL
PDSEKPVNWFGRGPHENYPDRILSAHIARHCCSIEEMHTPYIFPSENGLRCDVKDAIVGD
LTVSGDFHLAVSRYSQMNIAQAKHVNDLINDHQLYVRLDAFHMGVGGDDSWSPSVHDEFL
LNKEHYHYQMILAFN
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgagagagttttcagaaataattaaggcccgtgactgggaaaaccaagaggtaacgcac
caacatgttgttcaagcacatgcccctttacatgctttccactcaaaacaggccgcactt
gataatcaagcttcagaatttcaacaattattaaacggccaatggcgctttcagttattt
gctaaaccggaagcagtccccaatcattgtattaacattgattttgatgatagcgcctgg
tctgatatcactgtaccaagtaactggcagctgcagggttacgataagcctatttatacc
aatgtgaaatatccctttgcagataatccaccttttgtccctgctgataatccgaccggc
gtataccgcttaaatttcactttgccaactgcctggaaagaacgtaaaaacacggtcatt
tttgatggagtcaactcggcttttcacctttggtgtaatggtatttgggtcggttattct
caagacagtcgtttacccgcagaatttgatttaagctgccatctgcaggcgggagacaat
cagttaaccgtgatggtattgcgttggtccgacggctcctaccttgaagatcaggatatg
tggtggttgagtggtatttttcgcgatgtttgcctgctcagtaaaccgcttatctctatt
cgcgatattaccgttagcacagagttagatgcctgctttaatcatggcagtatcaatgta
gtgactcaactgagtgaacaaagtagccaatacactgctcaggtacagctatttgatgcg
caattacagcccgttactaagcttgtcggcgcaccctttggggagcgcatgattgacgag
aaaggcccggcaaacgatcgagccgaacataaaattgcagtaccatcaccgcataaatgg
agttcagaatcgccttatttatatcgtgtggttatttccctggtcgataatgagggccaa
gttgtcgacagtgaagcttatcaagtcggttttcgtgttgttgaaatgagtaatggccag
cttaaacttaatggtgaagcattattaattcgcggcgttaaccgtcacgagcatcatccg
gaaaaaggtcatgcgatttcttatgaagatatgcttgtagatattaagctgcttaaacaa
aacaatttcaatgcggtgcgcactgcgcactatcctaatcacccgctatggtatgaattg
tgcgatcaatatggtttgtatgttgttgatgaggccaaccttgaaacccatggacaattt
ccaatgtcacgtttgtccaatgatcttagctggttaaatgcgtatatgcgccgcatgaca
cgaatggttgagcgtgataagaaccacccttctattattatatggtcattaggtaatgaa
tccggtcttggtcatcatcatcatgccatgtatcagtggactaaacgcagagatccaacc
cgccctgtgcagtatgaaggtggcggtgcagacacggctgccacggatattatcgtgcct
atgtatgcccgcgtcaataaagacatcaccctgcctaatgcccccgatgtggtgcctaaa
atggcgattaaaaaatggctgtcgatgcccaatgaacagcgccctttgatcctctgtgaa
tatgcacatgccatgggcaacagcttaggcagttttgataaatattggcaggcctttcgt
gaatatccccgtctgcagggcggatttatttgggactgggttgatcagggtttaactaaa
atcgatgacaatggggataattactgggcatacggaggggattttggcgatcaaatcaac
gatcgacaattttgtattaatggccttgttttccctgacagaagtctacacccgaccgtt
tatgaagccaaaaaagcgcagcaattttatcaatttagcctggttgatggtgatcagctc
aaggttaaaatcgacagtgaaaatttatttatcgaaagtatggatgaaacactttgctgg
tcggtcaccgaagcgggttatgttatcgcctcgggtgagatggaattacatgtcacagct
caaagttcaaagattttaaccttacttgaaagctaccccgaacaaaaaataggctgtgac
tatttccttaatattgaaattgtattaaataaggataaaccctgggctacgaaaggtttt
gttgttgccactgagcaagttgcattagcatcgattgcacaattgacgaatgtgcccttg
attgagtcaggtgcgccgagactgagcgaagacaaaaacaagataaccgtggcaggtaca
ggttccggcgcagaatttgagcttgaaatagacaaacagcaaggtgtgatcagtcaatgg
ttagtgcgcggtgaaaataaaattttacagggacccaaggataactttttccgtgcgcct
ctggataatgatattggtaccagtgaggctgactgtattgatccaaatgcgtgggtgaca
caatgggacacggcaggaatagcgaatctggtgcctcactgtatcgcgatagaggcggtt
accttggcccggagtgtgcttgttaaggtggagtttggtcactacgttgagaataagcta
ttaatttccagtcactggcaatacaccataaataaccagggagaagtacagattgatgtt
aatgttaatcttgctaaatcactatcaccgttaccacgaattgggctggaattgattctg
cctgatagtgaaaagccagttaattggtttggtcgtggcccccatgaaaattatcccgat
aggattttatctgcacacattgctcgccattgctgctctattgaagaaatgcatacgcct
tatattttcccgtctgaaaacggtttacgttgtgatgtaaaggatgcaatagttggcgat
ttaaccgtatcaggtgattttcatttagcggtaagtcgctatagtcaaatgaatattgcg
caggccaaacacgttaatgacctcattaacgaccaccagctttatgtccgtttagatgct
tttcatatgggcgtgggcggcgatgattcctggagtccaagtgtgcatgacgagtttctt
ttaaataaggagcactatcattaccagatgattctggcatttaattag

DBGET integrated database retrieval system