KEGG   Psychromonas ingrahamii: Ping_2199Help
Entry
Ping_2199         CDS       T00450                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_2199 (tpiA)
   01230 Biosynthesis of amino acids
    Ping_2199 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2199 (tpiA)
   00051 Fructose and mannose metabolism
    Ping_2199 (tpiA)
   00562 Inositol phosphate metabolism
    Ping_2199 (tpiA)
Enzymes [BR:pin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ping_2199 (tpiA)
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ping_2199 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ping_2199 (tpiA)
  Exosomal proteins of melanoma cells
   Ping_2199 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2675712..2676464
Genome map
AA seq 250 aa AA seqDB search
MRTPLVMGNWKLNGTKESVSALIKGIEAAADAAKNVEVAVCPPTIFIEQVANLVANNSIE
LGAQDVSTNISGAFTGETSPVMVKEFGAKYSLVGHSERRQYHNETDAVVAAKFVAIQANG
LVPVLCIGETLEERETDKTFNVVETQLKAVIDVSGIDALENAVIAYEPVWAIGTGKVASS
EQAQDVHAHIRTWLAEQSKVVAAKVQILYGGSVKASSAKELFAQPDIDGGLVGGAALLVE
EFVGIIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccactagtaatgggtaactggaaattaaatggcacaaaagaatctgtatcc
gctttaatcaaaggcattgaagccgcagcagatgccgcaaaaaatgttgaagttgccgtt
tgcccgcccactatttttatcgaacaagtagcaaacctagttgcaaataacagcatcgaa
ttaggtgctcaagatgtaagcacaaatatttcaggtgcttttacaggtgagacttctcct
gtaatggttaaagaattcggtgcaaaatacagcttagtcggtcacagtgagcgtcgtcag
taccacaatgaaaccgatgccgttgtagctgcaaaatttgttgcaatccaggcaaatggt
ttagtccctgtattgtgtattggtgaaacgctagaagaacgtgaaactgataaaacattt
aatgttgtagaaacacagcttaaagccgttatcgatgtttcaggtattgacgcattagaa
aacgccgtcattgcatacgagccagtttgggctatcggcacaggcaaagttgcatcttca
gagcaagctcaagatgttcacgcgcacatccgtacttggttagcagagcaaagcaaagtt
gttgctgcaaaagtacaaatcctttacggcggcagtgttaaagcttcaagtgcaaaagaa
ttatttgcccagcctgacattgatggtggtttagtgggtggcgcagcattattggttgaa
gagtttgttggtattatagaaggtgctaaatag

DBGET integrated database retrieval system