KEGG   Psychromonas ingrahamii: Ping_2272Help
Entry
Ping_2272         CDS       T00450                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pin  Psychromonas ingrahamii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ping_2272
DNA repair and recombination proteins [BR:pin03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ping_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2761071..2761670)
Genome map
AA seq 199 aa AA seqDB search
MSSSSLLEDLMQALQCLPSVGPKSAQRMVYHLLDKNRKGALNLSSLLERAVNEIGHCQQC
RTFTEQNLCAICDNDKRNKNGMICVVEMPVDVLAIEQTALFSGTYFVLMGHLSPLDGVGP
EQLGLNLLDKQLSSGQHSEVILATNPTVEGEATAYYIAEMAKRYAIKVSRIAHGVPVGGE
LEYVDSTTLSHSFSGRSVF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagttccagttctttacttgaagatctaatgcaggcattacagtgcttgcccagtgtc
ggtccaaaatctgcgcagcggatggtttatcatctgctggataaaaatagaaagggggct
ttaaacctgagttctctgcttgaaagagccgttaatgaaataggtcactgccaacaatgc
cgtacttttaccgagcagaatttatgtgctatctgtgacaatgataaacgtaataaaaac
ggcatgatttgtgttgttgaaatgcccgttgatgtgttggcgattgaacaaacggctttg
ttttcaggtacctattttgtgctgatggggcatctttccccccttgatggcgttggaccg
gagcagcttggtttaaacctccttgataaacaactttcatcaggtcaacattctgaagtt
atattagcgacaaatccaacagttgagggtgaagcgacggcttattatattgccgagatg
gccaagcgatatgctataaaagtgagtcgaatcgcacacggtgtgccagtgggaggcgag
ctggagtatgtcgacagcaccacactttctcattcattttctggacgatctgttttttaa

DBGET integrated database retrieval system