KEGG   Psychromonas ingrahamii: Ping_2320Help
Entry
Ping_2320         CDS       T00450                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_2320
   01230 Biosynthesis of amino acids
    Ping_2320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2320
  Energy metabolism
   00680 Methane metabolism
    Ping_2320
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_2320
Enzymes [BR:pin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ping_2320
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ping_2320
  Exosomal proteins of melanoma cells
   Ping_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2821033..2821839)
Genome map
AA seq 268 aa AA seqDB search
MKIESVQKSGYQKPTLTELQKESTLPVGGEFIALIRHGAYAQLNNTPSAHQPFPLTVEGE
AEVVAQAQKFRLWLIANKLQLAPEVHSSNALRAWQTAQLYIRELSDCFTAIPTHLGFDSL
AERGLGCAANLTVSQIESVLANDPRFDTPPVDWKSNSHYCLPLQGGESLMMAGQRVADHI
ETVMQARKTAILADTADSKNALPQMHLFFGHGASFRHAACHLNVIEFKYISRLSMFYGQP
VILHRDATPWRHVAGNWKERHITAETLD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaatctgtccagaagagtggctatcaaaaaccgacgctaactgagttacaa
aaagagagcactttaccggtgggtggggagtttattgcgcttattcgccatggtgcttat
gcgcagctcaacaatacgcccagtgcgcatcagccatttccattaaccgttgagggtgag
gctgaggttgttgcgcaagcgcaaaagtttcgtctgtggcttattgccaataaactgcag
cttgcgcccgaagtgcattcttccaatgcactgcgcgcctggcaaacagcgcaactctac
attcgtgaattatcggattgttttaccgctataccaacacacttgggatttgatagtctc
gcggaacgtggtttgggttgcgcggcaaatttaaccgtctcgcaaatcgaatcggtactg
gccaatgaccctcggtttgatacgcctccggtggattggaaatccaatagccattactgc
ttaccactgcagggtggtgagtctttgatgatggcgggtcagcgagtcgctgatcatata
gagacggtgatgcaggcgcgtaaaaccgcgattttagccgatacagcagattctaaaaat
gctttgccgcagatgcatctgttttttggtcatggcgcatcatttcgacatgcggcttgt
catctaaatgtaatagagtttaagtatattagcaggcttagtatgttttatggtcaaccc
gttattctgcatcgcgacgccacaccttggcgacacgtcgccggaaattggaaggagcgt
catatcacggctgaaacccttgattag

DBGET integrated database retrieval system