KEGG   Psychromonas ingrahamii: Ping_2359Help
Entry
Ping_2359         CDS       T00450                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00052  Galactose metabolism
pin00500  Starch and sucrose metabolism
pin00520  Amino sugar and nucleotide sugar metabolism
pin00521  Streptomycin biosynthesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Module
pin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pin_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2359
   00052 Galactose metabolism
    Ping_2359
   00500 Starch and sucrose metabolism
    Ping_2359
   00520 Amino sugar and nucleotide sugar metabolism
    Ping_2359
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ping_2359
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ping_2359
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ping_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABM04096
JGI: Ping2359
UniProt: A1SX81
Position
complement(2870385..2871347)
Genome map
AA seq 320 aa AA seqDB search
MLAVVADVGGTNIRLAVCDLTSGKLSELKEFSCGQFLSLDAALLGYFATLQDQVKHLCIG
IACPVGDDLVAMTNLSWQFSQVALKAQLQLDSLYLINDYTAISLAVPFIDEQEKIKIGGG
KANKKGATAVFGPGTGLGVAHIINVADKWISLEGEGGHVSFTPNTREQTDILLLLQQQFG
HVSAERILSGQGLVNLYNSLCSLTGKQAVFSEPKQITKAALEGSCETSLQSLKVFCQVMG
GFAGNLGLNLACTGGVYIAGGIIPRFIDFFKASEFRDFFEAKGRFKDYLSGIPTYLITHD
NPGLLGASVYLRQELETIKN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagttgttgctgatgttggtggaacaaatattcgacttgctgtctgtgattta
acaagcggtaaactcagtgaattaaaagaattttcctgtgggcaattcttgagcttggat
gctgcacttttaggttattttgcaacgctacaggaccaagttaaacacttgtgtattggc
atcgcttgcccggtaggggacgatttggtcgccatgaccaatctaagttggcaattttct
caggtggccttaaaagcacaattacaattggattcgctttaccttatcaatgattatacc
gctatttcactggctgtaccctttattgatgagcaagaaaaaattaaaattggcggcggg
aaagcgaacaaaaagggtgctactgccgttttcggtccgggcacgggtttaggggttgca
catattatcaacgtagctgataaatggatcagtcttgagggggaagggggacacgttagt
tttactcctaacacccgtgagcaaacagacattttattgttactgcagcagcaatttggt
catgtttctgccgagcgtattttatcggggcaaggtttagttaatttgtataatagcctg
tgcagcttaacgggcaagcaggccgtttttagcgagccaaaacagataacgaaagccgca
ctagagggaagttgtgaaacgtcacttcaaagccttaaggtgttctgccaagtgatggga
ggctttgctggtaaccttggattaaatcttgcgtgtactggcggcgtctatatcgccggg
gggattataccccgttttattgatttctttaaagccagtgaattcagggacttttttgaa
gccaaaggtcgttttaaagactatctttctggcataccaacctatttaatcacccatgat
aatccgggtttattgggcgcaagtgtttatttacgccaagaacttgaaactattaagaat
taa

DBGET integrated database retrieval system