KEGG   Psychromonas ingrahamii: Ping_2359Help
Entry
Ping_2359         CDS       T00450                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ping_2359 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2359 (glk)
   00052 Galactose metabolism
    Ping_2359 (glk)
   00500 Starch and sucrose metabolism
    Ping_2359 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Ping_2359 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ping_2359 (glk)
   00524 Butirosin and neomycin biosynthesis
    Ping_2359 (glk)
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ping_2359 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2870385..2871347)
Genome map
AA seq 320 aa AA seqDB search
MLAVVADVGGTNIRLAVCDLTSGKLSELKEFSCGQFLSLDAALLGYFATLQDQVKHLCIG
IACPVGDDLVAMTNLSWQFSQVALKAQLQLDSLYLINDYTAISLAVPFIDEQEKIKIGGG
KANKKGATAVFGPGTGLGVAHIINVADKWISLEGEGGHVSFTPNTREQTDILLLLQQQFG
HVSAERILSGQGLVNLYNSLCSLTGKQAVFSEPKQITKAALEGSCETSLQSLKVFCQVMG
GFAGNLGLNLACTGGVYIAGGIIPRFIDFFKASEFRDFFEAKGRFKDYLSGIPTYLITHD
NPGLLGASVYLRQELETIKN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagttgttgctgatgttggtggaacaaatattcgacttgctgtctgtgattta
acaagcggtaaactcagtgaattaaaagaattttcctgtgggcaattcttgagcttggat
gctgcacttttaggttattttgcaacgctacaggaccaagttaaacacttgtgtattggc
atcgcttgcccggtaggggacgatttggtcgccatgaccaatctaagttggcaattttct
caggtggccttaaaagcacaattacaattggattcgctttaccttatcaatgattatacc
gctatttcactggctgtaccctttattgatgagcaagaaaaaattaaaattggcggcggg
aaagcgaacaaaaagggtgctactgccgttttcggtccgggcacgggtttaggggttgca
catattatcaacgtagctgataaatggatcagtcttgagggggaagggggacacgttagt
tttactcctaacacccgtgagcaaacagacattttattgttactgcagcagcaatttggt
catgtttctgccgagcgtattttatcggggcaaggtttagttaatttgtataatagcctg
tgcagcttaacgggcaagcaggccgtttttagcgagccaaaacagataacgaaagccgca
ctagagggaagttgtgaaacgtcacttcaaagccttaaggtgttctgccaagtgatggga
ggctttgctggtaaccttggattaaatcttgcgtgtactggcggcgtctatatcgccggg
gggattataccccgttttattgatttctttaaagccagtgaattcagggacttttttgaa
gccaaaggtcgttttaaagactatctttctggcataccaacctatttaatcacccatgat
aatccgggtttattgggcgcaagtgtttatttacgccaagaacttgaaactattaagaat
taa

DBGET integrated database retrieval system