KEGG   Psychromonas ingrahamii: Ping_2366Help
Entry
Ping_2366         CDS       T00450                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2366
Enzymes [BR:pin01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Ping_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABM04103
JGI: Ping2366
UniProt: A1SX88
Position
2881488..2882393
Genome map
AA seq 301 aa AA seqDB search
MLCHISLFKIKTLSTAISIQADAAGYEFLIIEHKKFNAAFALHGGHLVHFQLKEQQPIIW
LSKTAIYNQQKAIRGGVPVCWPWFGAADKSLGENLPAHGFARTSKWELAAHNEFPEGVEI
ELRLTDSAATRDIWPFQFELLLKATLTDQIKLELISKNTGNIPFSYRGALHSYLNISTPE
SCAISGLNNHYNDSLDNGLAKSGDSTLQITGPIDAIYKKALSPITLSDKQFNRQLIIDNS
GNDAEVLWTPWIAGAKAFADMPDQGYKTMFCIESAITNKSGVRVKPGHSHSLSTTIRSHT
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttatgtcacatttctctgtttaaaataaagaccttatccacagccattagtattcaa
gctgatgcagctggttatgaatttttaatcattgagcacaaaaaatttaatgccgccttt
gcacttcatggcggccatcttgtgcatttccaattaaaagaacaacagcccattatctgg
ttaagtaaaaccgccatttataatcagcaaaaggcaattcgtggcggcgtgcccgtttgc
tggccctggtttggtgctgccgacaaatcattgggagaaaacctgcctgctcatggattt
gcccgcaccagcaagtgggagcttgctgcgcataatgaatttcccgagggtgtagagatt
gaactgcgcttaaccgacagcgctgcaacccgcgatatctggcccttccaatttgaatta
ctgcttaaggcgacactaactgatcaaataaaacttgagctgattagcaaaaacactggc
aacattcctttctcataccgaggtgctttacactcttatttaaatattagtaccccagag
tcatgtgctatttcgggtttaaataaccactataacgattcgttagataatggcttggca
aaatctggtgatagtacattgcagatcacaggtcctatcgatgctatctacaaaaaagcg
ctttcccctattacattgtcagataagcagtttaaccgccaacttatcatagacaactca
ggtaatgacgctgaagttttatggacgccctggatagcaggtgcaaaagcttttgccgac
atgccagatcagggttacaaaaccatgttctgcattgaatctgctattacaaacaaaagt
ggcgtaagagtgaaaccgggccattcacacagcctatcaaccacaataagatctcataca
ggataa

DBGET integrated database retrieval system