KEGG   Psychromonas ingrahamii: Ping_2443Help
Entry
Ping_2443         CDS       T00450                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pin  Psychromonas ingrahamii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pin01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pin00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2991148..2992281
Genome map
AA seq 377 aa AA seqDB search
MSDSPVLALLKDLISRRSITPSDEGCQQLLISRLEKLGFECEVMIFADTTNLWARRGTEK
PLFCFAGHTDVVPTGPEENWTYPPFEPTVVDGFLFGRGAADMKSGIAAFIIALEQFIKAH
QDHQGSIALLITSDEEGPFINGTVRVIETLEARNEKIDYCIVGEPSSTEHVGDTIKNGRR
GSLTADLTINGVQGHVAYPHMVENPIHTCIGPLTELSQMEWDKGNKYFPPTSFQVTNFNA
GTGASNVVPGEAQIQFNFRYSTELTAEMIIARVVAILQKHKLNYQIKWTYNGSPFITQPG
SLTNAVSEAIFAVNGLTTELSTSGGTSDARFIAPTGAQVVELGPGNKTIHKVNESVKIAD
LEELVHIHRLTLEKLLT
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacagcccagttttggctcttttaaaagacttaataagccgacgttcgattacc
ccaagcgacgaagggtgccagcagttattaatatctagacttgaaaaattaggctttgag
tgtgaagtaatgatctttgcagatactaccaatttatgggcacgcagaggcacagaaaaa
ccgcttttttgttttgcgggacacaccgatgtggtaccaaccggccctgaagaaaattgg
acttaccctccctttgagccaaccgttgtcgatggttttttatttggccgtggcgctgcg
gatatgaaaagtggtattgccgcttttatcattgcgttagagcagttcatcaaagcacac
caggatcaccagggttccattgccttacttatcaccagcgatgaagagggaccttttatc
aacggcacagtgcgcgtaattgaaacacttgaagcgcgcaatgaaaaaatagattattgt
attgttggagagccctcaagcacagagcatgtgggtgatactattaaaaatggtcgcaga
gggtcattaacggccgatttaaccattaatggcgtacagggtcacgtggcttacccgcac
atggtcgaaaaccctattcatacctgcatcggaccgctcactgagttatcacagatggag
tgggataagggtaataagtatttcccaccaaccagttttcaggtaaccaattttaatgct
ggcacgggcgcgagtaatgttgttcctggagaagcacagattcagtttaattttcgttat
tcgaccgagttaacagccgagatgataattgcacgtgtggtagctattttgcaaaaacat
aagcttaattaccagattaagtggacttataacggctcaccatttattacccaaccaggt
tcgttgactaatgccgtaagtgaggctatctttgctgtcaatggattaacaactgagctt
tccaccagtggtgggacctccgatgcacgttttattgcaccgacaggagcgcaagttgtt
gaactgggtcccggcaataaaaccattcacaaagtgaatgaatcagtaaaaattgccgac
ctggaggagctggtacatattcaccggctgactctggaaaaattgttaacatga

DBGET integrated database retrieval system