KEGG   Psychromonas ingrahamii: Ping_2486Help
Entry
Ping_2486         CDS       T00450                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
pin  Psychromonas ingrahamii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3038101..3041133)
Genome map
AA seq 1010 aa AA seqDB search
MKLKFKHQGYQADSVQAIVDCFKGQLINDTASRYRIDPGQLAKGRTGSLGQDDAGFRNTD
IQANVRILENIQKAQRHQNLPQSLKLVNTKACLINLDIEMETGTGKTYCYVKSIFELNKH
YGWSKFIIVVPSIAIREGVHKTLEITAEHFLEDYSKRARFFIYNSKDLHQIENFSSDGGI
NVMVINVQAFNARGKDARRIYEELDDFQTRRPIDVIKANRPIMILDEPQKMEGAKTLDSF
AEFNPLFILRYSATHKTEHNKVYRLDALDAFNQKLVKKIGVRGITTKGLAGTNAYLYLEN
IEISTSKPPVARVEFEQKLKSGSIKRIVRKLGKGDNLYDLSDGLDQYQGFVVSDINAVKD
TISFLNGHELYVGEASGDVNESALRRIQIRETVKAHFEKELQLFDQGIKVLSLFFIDKVA
KYRNYAADDDKGEYAHVFEEEYNRCLNEYTQLEDSPYQRYLKGITADRTHNGYFSIDKKS
KHMVDPKTAARSTETDDVDAYDLILKDKERLLSFEEPTRFIFSHSALREGWDNPNVFVIC
TLKHSDNTVSRRQEVGRGLRLAVNQFGDRIDDPSIVHDINRLTVVASESYKDFVSALQRD
ISDSLSARPKVANEEYFTGKILVTEEGDVEITAALAKQIYRYLLKNDYTDDKDHITDEYH
NAKRDDQLATLPESLQPYAPQIIQLIDSVYSDAQLPDIADERKAKCNELNGNFYKKEFKE
LWSRINHKAIYQVEFDSEELVVKSIKSLDDKLRVEKLHFDVVRGEQSDAVSYEQIKAGQG
FSVIDHEIENYDASIDSRVKYDLLGKVAELTKLKRNTVAKILSGISHHIFAQFKNNPEDF
IAKGINLINEQKATMVIEHLTYDTIADKFKSNIFTASKKQDFSAAGKPLNNHIYDYVVTD
SKTERKFVEELDTSKEVTVYAKLPSGFFIPTPVGNYNPDWAIAFQEGTVKHIYFVAETKG
SLQSLQLKGAELAKIECAKRFFEKVNEQISSDHVKYDVCVNYDDLKRLVM
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaatttaaacatcagggttatcaagccgactctgttcaagcgatagtagat
tgttttaaagggcaattaattaatgatactgctagtcgataccgaatagaccctgggcaa
cttgctaaagggcgaacaggaagtttaggacaagatgatgcaggattccgtaatactgat
attcaagctaacgttagaatattagaaaacattcaaaaagcgcagcgtcatcaaaacctt
cctcaatccctaaaattggttaataccaaagcttgccttatcaacttagatattgagatg
gaaacaggtacaggcaaaacctattgttatgttaagtcgatatttgaactcaataaacat
tatggttggagcaagtttattatagtggtgccaagtattgctattcgtgaaggtgtgcat
aagacattagaaattaccgctgaacactttttggaagattatagtaaacgagcacgtttc
tttatttataattctaaagatttacatcaaatcgaaaacttttcatctgatggtggcatt
aacgtgatggtgattaacgttcaggcgtttaatgcccgcggtaaagatgcacgtcgtatt
tatgaagaattagatgactttcaaacgcggcgtcctattgatgtaataaaagctaaccgc
ccgattatgattttggatgaaccacagaaaatggaaggggcaaaaacactcgattcattt
gctgaatttaatccgttatttattttacgttattctgctacacacaaaactgaacacaat
aaagtttatcgattagatgccctcgatgctttcaatcaaaaactcgttaaaaaaataggt
gtgcgtggaataaccactaaaggtttagcgggaactaatgcttacctttatctagaaaat
atagagatatcgacaagcaagccaccagttgctcgcgttgagtttgaacagaaattaaaa
tcaggctctatcaagcggatagtacgtaaattaggcaagggtgataacctttatgacttg
tcggatgggttagatcaatatcaaggttttgtagtatctgatattaatgccgttaaagac
acaatcagctttttaaacggccatgaactttatgtgggagaagctagcggcgacgttaat
gaatctgctctgcgccgaattcaaatacgtgaaacggttaaagcacattttgaaaaagag
ctgcaattgtttgatcaaggcataaaagtactctctttattctttatagataaagttgct
aaatatcgaaattatgcagcagacgatgataaaggagaatatgcccatgtatttgaagaa
gagtacaaccgttgcctaaatgagtacacccaacttgaagactcgccatatcagcgatat
ttaaaaggtattactgccgatagaacgcataatggttatttttcgatagataaaaaatct
aagcacatggttgatccaaaaacagcggctcgctcaacggaaacagatgatgttgatgct
tatgatttaattcttaaagataaagagcgcttattaagctttgaagagcctacgcgtttt
atcttctcacattcagcacttcgggaaggttgggataatcctaacgtatttgtaatttgt
acactgaaacatagtgataatactgtatcacgtcggcaagaagtaggccgaggtttacgt
ttagctgttaatcaatttggtgatcgtatagatgacccatcaattgttcatgatatcaac
cgattaactgttgttgccagtgaaagttataaagactttgttagtgcattacagagagac
atcagtgattcattatctgctcgacctaaagttgcaaatgaggaatattttaccggaaaa
attttggttacagaagaaggtgacgtagaaataactgcagcactagccaaacaaatatat
cgttatttactgaaaaatgattataccgacgataaagatcatattactgacgaatatcat
aatgcaaaacgagatgaccaattagcgacattaccagagtcattgcagccttatgcacct
caaattattcaactcattgattcggtatactcagatgctcaattacctgatatagccgat
gagcgtaaagcaaaatgcaatgagcttaatggaaatttttataaaaaagaatttaaggag
ctttggtcacgaattaaccataaagccatatatcaagtcgaattcgattctgaagagtta
gtagttaaatcaattaagtcattagacgataaattacgtgtggaaaagttacattttgat
gtggtgcgtggtgagcagagtgatgctgtaagctatgaacaaataaaagcaggccaaggg
tttagcgttattgatcatgaaattgaaaactacgatgcctctattgattcacgtgttaaa
tatgacttgttaggcaaagtggcggaattaaccaagctaaaacgaaacactgttgccaaa
attttaagtggtattagtcatcatatatttgcacagttcaagaataatccagaagatttt
atcgcaaaaggtattaatttaattaacgagcaaaaagcaacaatggttatcgagcattta
acctatgacactattgctgataagttcaagagtaatatttttacggcaagtaaaaaacaa
gatttttctgcggcgggaaaacctttaaataatcacatttatgattatgtcgtgactgat
tcaaagactgaacgtaaatttgttgaagagttggatacaagcaaagaagttactgtttat
gccaaactgccaagtggtttttttattcctacaccagttgggaactacaacccggactgg
gcaatagcgtttcaagaaggaacggtaaaacacatttattttgttgctgaaaccaaaggc
tcattgcaatcgcttcaattaaaaggtgccgaattagccaagatagaatgtgcgaaacgt
ttttttgaaaaagtgaatgaacaaatatcttctgatcacgttaagtacgatgtatgtgtg
aattatgatgatttgaaacgcttggttatgtag

DBGET integrated database retrieval system