KEGG   Psychromonas ingrahamii: Ping_2600Help
Entry
Ping_2600         CDS       T00450                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pin  Psychromonas ingrahamii
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pin00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3189981..3191756)
Genome map
AA seq 591 aa AA seqDB search
MSDFKRKAKSLKNCQKKLNQQLESIYQDIDLDVTFEELSEKLIFLMRLDKTCHAPVAAQN
KWSEQDVILITYADSLLEADKKPLVTLHHFIDKYLGKSINSVHILPFFPYSSDDGFSVID
YSSVNESFGDWKDIQAIAKDRRLMSDLVINHCSSRSAWFQNFIKGEGVGHDFFYTASPDD
DLSKVVRPRTSALLNEIQTGKGLQHVWCTFSHDQVDFDFRNPVVLENFVTIIRQYLDMGV
RIFRLDAVAFLWKKAASECINLPETHTIIRLLRTLIEHAQPDAIIITETNIPNVQNLTYF
GNANEAHAIYNFALPPLLVHTLVSGDCKHLKRWLMSMPPAQNGTCYFNFIASHDGIGLRP
VEGLLSDQELNRLAVTLEGFGGKTSWRTTDQGQQKPYEINIALYDALQGTTEGEDKLGFY
RFICAHSIMLGLEGIPGIYIHSLLGTRNDYEKLENTQHNRAINRHRWDYNTLKEKLSGHP
DHHKNVLSELKHLINIRIKQKAFHPNATQFTLHLREQLFGFWRQSQDRAQSIFCISNVSK
NTLDLSLSELNLIITESWYELITGAKIAPGQETVSLLPYQTLWISNLDMDI
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattttaagcgcaaagcaaaatcattaaaaaattgtcaaaagaaattaaatcaa
cagctggaaagtatctatcaggatattgatttagatgttacttttgaggaattaagtgaa
aaattaatatttttaatgcgtttagataagacctgccatgcacctgttgcagctcaaaat
aagtggtcagagcaggatgttattctgatcacctatgcagacagtctgctagaagcggat
aaaaaacccttggtgacactgcatcactttattgataaatacttaggtaaaagtatcaac
agtgtgcatatcttacctttttttccctatagctctgatgatggtttttcagtcattgat
tattcaagtgtgaatgaatcatttggtgactggaaagatattcaagcaatcgccaaagat
aggcgcttgatgtcagacctggtgattaaccattgctctagccgcagtgcctggtttcaa
aattttattaaaggggagggtgtcgggcatgactttttctacacagcaagccctgatgat
gatctttccaaggtggtacgtcccagaacgtcagcgttattaaacgaaattcaaacgggg
aaaggtctgcagcatgtttggtgtacttttagtcatgatcaggttgattttgattttagg
aatcccgtggtgctggaaaactttgtgactattattcgccagtatctggatatgggcgtc
agaattttccgtttagatgctgtggcatttttgtggaaaaaagccgcaagcgagtgcatt
aatttacctgaaactcatactattatccgcttgcttcgaaccttaattgagcatgcacaa
cccgatgcgattattattactgaaactaatatccctaatgtacaaaatttaacctatttt
ggtaatgccaatgaagcgcatgccatttataattttgcattaccgcctttattagttcat
accctagtcagtggtgattgtaagcatcttaagcgctggttgatgagtatgcctcccgca
caaaatggcacctgctatttcaattttatcgcttcccatgacggcatcggtttgcgtcct
gtggaggggttattaagtgatcaggaactaaacagactagcggtgacattggaaggcttt
ggcgggaaaacctcctggcgtactacggatcaaggccagcaaaaaccctatgaaattaat
atcgccttatacgatgcactgcaaggcaccactgaaggtgaagacaaactgggcttttac
cggtttatttgtgctcatagcatcatgcttggtctggaaggtatacccgggatatacata
catagcctgttaggcacccgaaacgactatgagaaattagaaaatacacagcataataga
gccattaatcgtcatcgttgggactataataccttaaaagaaaagttatctggacatcct
gatcaccacaaaaatgttttatctgagttgaagcacttaattaatattcgtataaaacaa
aaggcatttcatcctaacgcaacacaatttacactgcatttaagagagcaattatttggt
ttttggcgacaaagccaagatagagcacagagtattttttgtattagcaatgtcagtaaa
aatacgctggatctatctctcagtgaattgaacttaattattactgaaagctggtatgag
ttaatcacgggggctaaaattgcacctgggcaagaaacggttagtttattgccttatcaa
acgctatggataagcaaccttgatatggatatttga

DBGET integrated database retrieval system