KEGG   Psychromonas ingrahamii: Ping_2604Help
Entry
Ping_2604         CDS       T00450                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00071  Fatty acid degradation
pin00280  Valine, leucine and isoleucine degradation
pin00281  Geraniol degradation
pin00310  Lysine degradation
pin00362  Benzoate degradation
pin00380  Tryptophan metabolism
pin00410  beta-Alanine metabolism
pin00640  Propanoate metabolism
pin00650  Butanoate metabolism
pin00903  Limonene and pinene degradation
pin00930  Caprolactam degradation
pin01040  Biosynthesis of unsaturated fatty acids
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
pin01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ping_2604
   00650 Butanoate metabolism
    Ping_2604
  Lipid metabolism
   00071 Fatty acid degradation
    Ping_2604
   01040 Biosynthesis of unsaturated fatty acids
    Ping_2604
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ping_2604
   00310 Lysine degradation
    Ping_2604
   00380 Tryptophan metabolism
    Ping_2604
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ping_2604
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ping_2604
   00281 Geraniol degradation
    Ping_2604
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ping_2604
   00930 Caprolactam degradation
    Ping_2604
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Ping_2604
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ping_2604
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Ping_2604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 IRF-2BP1_2
Motif
Other DBs
NCBI-ProteinID: ABM04323
JGI: Ping2604
UniProt: A1SXV8
Position
complement(3196266..3198440)
Genome map
AA seq 724 aa AA seqDB search
MNFTLDISQSGPTSGVATLTFDFPGARVNKLDSVALLELKGQIDSLAKNNVVKLLVFRSA
KKDTFIAGADINEIKDLLNEAQAYKEIRTGQLIIDNISKLPFPTLAVINGVCLGGGCELA
LACTYRIATDNLNAIIGLPEVSLGIIPGFGGCVRLPKLIGLQAALQLILSAKPVAPKKAL
RLKLVDHLYNNELEESSVADFIERLVNDKSFVKGLIKRRSKSAKKFNQRILEDNILGQKL
IFKKAKDSLLKKNKGQYPAPLKALETIEKSFNLKIAEALEVEARAISELAVSVISKNLIQ
LFFTSEALKKETGIVESNLEPQIINQAAVLGAGVMGGGIAWLFSKNEIPVRLKDIEWDAV
SKGYQTAALYYGQLKKVHKINENKIRVKMNYIAGTVNYNGFKRIDLVVEAVSENLEVKKT
VLEEVEAQLSKQAILASNTSSLSITEMAVNLQRPENFIGMHFFNPVNRMPLVEIIPGEKT
SQQTIVTLVKLAKKAGKTPIVVANCAGFLVNRILISFLNEAALMLQEGGVVTEMDHALEA
FGLPMGPFVLADEVGIDIGYHVAKVLEQAYGERMKVAGLFTQIFIDEKLLGKKSGVGFYR
HKGHDKSYNEALDKIIYTYRFSNGITAKAFNQEEIVDRCILIMVNEAVKCLQENIVKNPA
YLDMAMILGTGFPAFTGGLLKYADNRGIGNICDTLNQLAALYGERFLPAEQLIDKAKNGG
KFYN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaattttacattagatatttcacaatcaggcccaacttcgggggttgcaacattgacc
tttgattttccgggggcacgagttaataaattagattcagtcgcattattagagctcaaa
gggcagattgattctctggcaaaaaataatgtcgttaaactgttggtctttcgcagtgcc
aaaaaggatacctttattgccggcgctgatatcaatgaaattaaagatctgcttaatgag
gcacaagcttataaagaaataagaaccgggcagttaattattgataatatttctaaatta
ccttttccaaccttagcggttataaacggggtctgtctgggtggcggttgtgagttagcg
ttagcttgtacttatcgcatcgccacggataatcttaacgctattataggcttacccgag
gtcagtttgggtattattcccggttttggcggttgtgtgcgtttaccaaaactgattggc
ttacaagctgctctgcagttaatactgtccgctaaacctgtcgcccctaaaaaagcgctg
cgactcaaattagtcgatcatctctataataatgagcttgaagaaagttcagtcgctgat
tttatcgaacgtttagtgaatgataaaagctttgtgaaagggttaataaagcgccgttca
aagtctgctaagaaatttaaccagagaattttagaagataatattttagggcaaaaactg
atttttaaaaaagccaaagacagtttgcttaaaaaaaacaaaggtcaatatcccgcgccg
cttaaagctttagaaaccatagaaaaatcattcaatttaaaaatagcggaagcgttagag
gtagaagcgagagccatttctgagcttgctgttagcgtaataagtaaaaatttaattcaa
cttttttttacctctgaggcattaaaaaaagaaaccggtattgtcgaatccaatcttgag
ccacaaataattaatcaggccgcggtactcggcgcaggggttatgggcggggggatcgcc
tggttattttcaaaaaatgagataccggtcaggcttaaagatattgaatgggatgcggtc
agtaaaggttatcaaaccgcggcgctctattatggacaattaaaaaaagtccataaaatt
aacgaaaataagatccgcgttaaaatgaattatattgcagggacggtcaattataacggt
tttaaaagaattgatctggttgttgaagcggtgtctgaaaatctagaggttaagaaaaca
gtcctggaagaggttgaagcacagctgtctaagcaggcgatattagcgtcgaacacctcg
agtttatccattactgagatggctgtaaatctgcaaaggccggaaaattttatcggtatg
catttttttaatccggttaacagaatgccgcttgttgaaattataccgggggagaaaacc
agccaacagaccattgtcacattggttaaactcgctaaaaaagccggtaaaacacccatt
gttgttgctaactgtgcaggttttttagtcaatagaattttaatttcatttttgaatgaa
gccgctctgatgcttcaggagggaggcgttgttaccgaaatggaccatgctcttgaagca
ttcgggttgccgatgggaccttttgttttagccgatgaggtcggtatcgatattggttat
catgttgcaaaagtattagagcaagcctatggcgaaagaatgaaagtggcgggtttattt
acccaaatttttatcgatgagaagttattaggtaaaaaatcgggtgtgggtttttaccgc
cacaaaggccacgacaaatcctacaatgaggcgctggataagattatctatacttatcgt
tttagcaatggaataacagccaaagcatttaaccaggaggaaatcgtagacaggtgcatt
cttattatggtcaatgaagcggtcaaatgtttacaggaaaatattgttaagaatccggct
tatctggatatggcaatgatcctcggtacaggttttcctgcatttacaggcggtctttta
aaatatgccgataatcgtggcatcggcaatatttgcgatacattaaatcaattagcggct
ttatatggtgagcgttttctgcccgctgagcaattaatagataaagcaaaaaacggcggg
aaattttataattag

DBGET integrated database retrieval system