KEGG   Psychromonas ingrahamii: Ping_2635Help
Entry
Ping_2635         CDS       T00450                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00330  Arginine and proline metabolism
pin00332  Carbapenem biosynthesis
pin01100  Metabolic pathways
pin01130  Biosynthesis of antibiotics
pin01230  Biosynthesis of amino acids
Module
pin_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ping_2635
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Ping_2635
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Ping_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABM04353
JGI: Ping2635
UniProt: A1SXY8
Position
complement(3232755..3233633)
Genome map
AA seq 292 aa AA seqDB search
MNTNTNTNTKPKTKNNTKRVVIKVGSAVLTDNNNIAKERMLNLVSMISGLRKTYDVILVT
SGAVAAGYSTLKLDKSKQIGKKALAAAGQPILMTAYKKKFDIYDIDTAQILLTEDDFDSR
KRTKMFQEIIDAHLTHDILPIVNENDITSTPEQQFGDNDQLSAVVAHATNAEILVILSDI
DGYFDKNPHEYQDAKIFKTMSKIPEQALLDESTPNNSFATGGIVTKLKAANFLIRHGRKM
LLCNGFDLSAAESFLLENKHTLGTLFLPEEEAKKSSESASKKSAENAIKKES
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaatactaatactaatacaaagccaaagacaaaaaataatacaaaacgtgta
gtgattaaagtcggcagtgcagtattgacagataataataacattgccaaggagcgcatg
cttaacttggtatctatgatctctggactaagaaaaacctacgacgtcattcttgtgact
tccggtgcggtcgcggcagggtactcgactctaaagcttgacaaaagtaaacagattggc
aagaaggcacttgcagcggcaggtcagcctattttaatgacggcctataaaaagaaattt
gatatctatgatatcgacactgcgcagatcctgcttacagaagatgattttgactcaaga
aaacggactaagatgtttcaggaaataatcgatgctcatctgacacacgatatcctgcca
atcgtcaatgaaaacgatattacctcaacaccagaacagcagtttggcgacaatgaccag
ctatccgctgttgtggctcatgcaaccaatgctgaaattctggttattttgagcgatatt
gacggatattttgataaaaatccgcacgaatatcaagatgcaaaaatctttaaaaccatg
agcaagatacctgagcaagcgctacttgatgagtcgactcctaataacagttttgccacc
ggaggcattgttacaaaacttaaggcagctaactttcttataagacatggaagaaaaatg
cttctgtgtaacggttttgatctaagcgccgcagagtcatttttgttggaaaataaacac
actttgggtactctctttctgcctgaagaggaggctaaaaagtcgtctgaaagcgcgagc
aaaaagtcagctgaaaacgcaatcaaaaaagagagctaa

DBGET integrated database retrieval system