KEGG   Psychromonas ingrahamii: Ping_2841Help
Entry
Ping_2841         CDS       T00450                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2841
Enzymes [BR:pin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Ping_2841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3491591..3492994
Genome map
AA seq 467 aa AA seqDB search
MSFRFPNDFLWGGATAANQIEGAHTIDGKGLSTSDVQPFGSFGELKSRKEGDFNIKDIAI
DFYHRYPQDIALFAELGFTCFRLSIAWSRIFPKGDEQEPNELGLAYYDKIFNELEKYGIV
PIVTLSHYEMPLYLAEQYQGWKSRELIGFFERYARTVFARYGNSVKHWLTFNEINISLHE
PFTGAGIPRGSDAQSLYQGMHHQLVASAKAVKACHELLPDAKIGNMMLGAIQYPYTCHPD
DIFAAMQENRDWLFFGDVQCRGYYPSYMARKFKELGVKLDISEADKETLKETVDFVSFSY
YMTGCVSTHQEVEILDKKALKMGSNPYLKTTDWGWQIDPKGLRIVLNLLYDRYQKPLFIV
ENGLGAVDKPNEKGEIEDDYRIAYLNDHLYQVGEALQDGVEVMGYTCWGPIDLVSASTAQ
MSKRYGLIYVDSDDQGKGSLVRKRKKSFYWYQDLIKSQGENLTPPSA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcgttttccaaatgattttttatggggtggagcaaccgctgccaaccagatt
gagggagcacataccattgatggaaaagggttatcaacttctgatgtacaaccttttggc
tccttcggtgaactaaaatcgcgtaaagagggtgattttaacattaaagatattgctatc
gatttttaccatcgttatccgcaggatattgcattatttgcagaacttggattcacctgt
tttcgtttatctatcgcctggagccgaattttccccaagggggatgaacaagagcctaat
gaattaggtttggcctattacgataaaatatttaatgaattagagaaatatggcattgtc
cctattgttaccctctcccactatgagatgcctttatatctggcagagcaataccagggc
tggaaaagcagagaattaatcggtttttttgaacgttatgctcgtactgtgtttgcccga
tacggcaacagcgtaaaacattggctaacctttaatgagataaatatctccctgcatgaa
cctttcaccggggcgggcattccgcgcggcagtgacgcacaaagcctttatcaaggcatg
caccatcaacttgtggccagtgccaaagccgttaaagcctgccatgagctgttgcccgat
gcgaaaataggcaatatgatgttaggcgcaattcaatatccttacacctgccaccccgat
gatatctttgctgctatgcaggaaaatcgcgattggttatttttcggtgatgtgcaatgc
cgtggttattatccaagttatatggcacgtaaatttaaagagctgggtgttaagctggat
attagtgaggccgataaagaaaccttaaaagagacagttgattttgtctcttttagctat
tacatgacaggctgtgtcagcacccatcaagaggtggaaatactcgataaaaaagcatta
aaaatgggcagtaatccttatttaaaaaccaccgactggggatggcaaattgatcctaaa
ggtctgcggattgtgcttaatttactctatgatcgttaccagaaaccgttatttattgtt
gaaaatggcttaggtgcggttgataagcccaatgagaagggcgagattgaggatgattat
cgtattgcctatcttaatgatcacctctatcaagtgggtgaagcgctgcaggatggtgta
gaggtgatgggttatacctgttggggaccgattgatttagtcagtgcctcaacggcgcag
atgtcgaaacgttatggccttatctatgttgacagcgatgatcagggcaaaggcagctta
gtgcgcaaacgtaaaaaaagcttttactggtatcaggatctgattaagtcacagggtgaa
aatctcaccccgccatctgcataa

DBGET integrated database retrieval system