KEGG   Psychromonas ingrahamii: Ping_2865Help
Entry
Ping_2865         CDS       T00450                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pin  Psychromonas ingrahamii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ping_2865
Enzymes [BR:pin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Ping_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3545220..3546560
Genome map
AA seq 446 aa AA seqDB search
MILLPQEIIRNKRDGKTLSRQEIDFFIKGITDNSVTEGQIAAFAMAVYFQDMNMDERVLL
VSAMRDSGQVINWQSLNLNGPVVDKHSTGGVGDVTSLILGPMVAACGGYVPMISGRGLGH
TGGTLDKLDAISGYKTTPDSLDHFRKIVKEVGVAIIGQTGDLAPADKRFYATRDITATVE
SIPLITASILSKKLAAGIDALVMDVKAGSGAFMPTFEQSEALANSIVGVANGAGCKTSAL
ITNMDQVLASSAGNAVEVREAVRFLKGEVVNPRLHEVTMALCAEMLLLSGLAADIKEAQA
KLQKVLDNGKAAEVFAKMVGALGGPADFIENQDNYLQKSAIVRPVYAQHSGIVQSMDTRA
LGMAVVNLGGGRHSASDSIDYAVGLSGILSLGESADSEKPLAMIHAQSEKQFSEAQRAIQ
SAIICGTDSLQAQTQVYRHIRLPDIS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatattattgccacaagaaattattcgtaacaaacgtgatggcaaaaccctcagcagg
caagaaattgatttttttattaaagggatcaccgataactcagtcacagaaggtcaaatt
gccgcctttgcgatggctgtctatttccaggatatgaacatggatgaacgtgttttactg
gtatctgcaatgcgtgattcagggcaggtaataaactggcagtcgcttaatctgaatggt
cccgtggtggataaacattcaacgggcggggttggagatgtcacatcactgatattaggc
ccgatggtggccgcctgtggcggttacgtgccgatgatttcaggccgtggattgggtcat
accggcggcacgttggataagctcgatgctatttccggttataaaacaacgcccgatagc
ctggatcatttccgcaaaatagtcaaagaagtgggtgttgcaattatcggtcaaacgggt
gatttagcgccggctgataaacggttttatgcaacccgtgatattaccgcgacggtggag
tccattccgttaataaccgcatcaattttatcgaaaaaattggccgcaggtattgatgcc
ctagtaatggacgttaaagccggcagtggtgcatttatgccaacttttgagcagtccgag
gctttggccaacagtattgttggcgttgctaatggtgctggatgtaaaaccagtgcttta
attactaatatggatcaggtacttgccagcagtgcaggtaatgctgttgaagtacgtgaa
gccgtgcgctttcttaaaggggaagttgttaatccccgtttacatgaagtcaccatggca
ttatgcgctgaaatgctgctgttaagcggcttggcagcagatataaaagaggctcaagca
aaattacaaaaagtacttgataacggtaaagccgcagaagtctttgccaaaatggttggc
gcgctgggcggccccgctgattttattgaaaatcaggataattatctgcaaaaatcggcc
attgtccgtcctgtttatgcccaacattcagggattgtacaatctatggataccagagca
ttagggatggcagtggttaatctgggcggaggacgacatagtgcatcggattcgattgat
tatgccgttggtctcagcggtatactctctttgggtgagtcagcagactctgaaaagccg
ctggcaatgatccatgcacagagtgagaagcagttcagcgaagcacagcgcgccattcaa
agcgccattatttgtggcacagacagtcttcaagctcagactcaggtttatcgtcatatt
cgtttaccggacatctcttaa

DBGET integrated database retrieval system