KEGG   Psychromonas ingrahamii: Ping_2926Help
Entry
Ping_2926         CDS       T00450                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00020  Citrate cycle (TCA cycle)
pin00620  Pyruvate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Module
pin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2926 (sucB)
   00020 Citrate cycle (TCA cycle)
    Ping_2926 (sucB)
   00620 Pyruvate metabolism
    Ping_2926 (sucB)
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ping_2926 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N GCV_H HlyD_D23 Biotin_lipoyl_2 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABM04628
JGI: Ping2926
UniProt: A1SYR3
Position
complement(3608602..3610233)
Genome map
AA seq 543 aa AA seqDB search
MSELKEFLLPDIGADAADITDILVSVGDTIAVEQDVLTIEGDKASMDVPSSVAGVVKEIK
VKVGDSVSEGNLVLMVEVEVADADAPAADAPAAEAPASPVEEASPAVEAPAAATTQLKEI
SVPDIGGDEVEVTAILVSVGDSIAEEQDILTVEGDKASMDVPAPFAGVVKEIKAAVGDKV
SEGSLILVVEVQGAAPAPAPAAAEPAPTPAEPAPAAAAPVAAAAEAPKAAAQLSPSQVSV
AGSIKASPSVRRTAREFNLDLSVIPATGIKGRTTKEDVQTYVKAQLLLAKSGGGGGLQVL
ASPKVDFAKFGEVEVKPLSRIQKISGPTLHRNWVTIPHVTQFDEVDITELEAFRKEQNAI
AVKRDLGLKISPLVFMMKAVAKALQQYPDFNSSLSADGESLILKKYINIGIAVDTPNGLV
VPVVKDVINKGIYDLSRELGEISKKARAGKLTTRDMQGGSMTISSLGGIGGTQFTPIVNA
PEVAILGVSKSAMKPLWNGKEFEPRLMVPLALSYDHRVIDGAEGARFITAINNYLSDLRT
LIL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattaaaagaatttttactgcctgatattggtgccgatgcggctgatattact
gatattttagtatctgttggtgacactatcgccgtggagcaagatgtattaaccattgaa
ggtgacaaagcctcgatggatgtaccctcatcggttgccggtgtggttaaagaaattaaa
gtgaaagtaggtgacagtgtttctgaaggtaacctagtactgatggttgaagttgaagtt
gctgatgctgatgcgcctgctgccgatgcacctgctgctgaggcacctgcttcacctgtg
gaagaagcgagccctgcggttgaagcgcctgctgctgcaacgactcaattaaaagaaata
tctgttcccgatatcggtggtgacgaagttgaagtgacggcaatccttgtttctgttgga
gatagcatagcggaagagcaagatatcctaacggttgaaggcgataaagcgtcaatggat
gtccctgcaccctttgcgggtgtagttaaagaaattaaagccgctgtgggtgataaagtt
tctgaaggttcattaattttagtggttgaagtacaaggtgctgctcctgctcctgctccc
gctgctgctgaaccggctcctactcctgctgaacccgctcctgcagccgctgcgcctgtt
gctgccgctgctgaagcaccaaaagctgctgctcaacttagcccctcacaggtttctgtt
gccggctcaattaaagcttctccttcggtgcgccgtactgcgcgtgagtttaatttggat
ctttcggttattccagcaacgggtattaaaggtcgtacgaccaaagaagacgtacagact
tatgttaaagcacagctattgctggctaaatctggcggcggtggtggcttgcaagtgctt
gcttctccaaaagttgatttcgctaaatttggcgaagtggaagttaagccactttcacgt
atccaaaaaatatcaggtccgactctacaccgtaactgggtaactatcccgcatgttaca
caatttgatgaagtcgatatcactgaacttgaagcgttccgtaaagaacaaaatgcgatt
gcagttaagcgcgacttaggtctgaaaatcagtccgttagtctttatgatgaaagcagtg
gctaaagcactgcaacaatatcctgattttaactcttcattatcagccgatggtgaaagt
ttaatcctgaaaaaatacatcaatatcggtattgcggtcgatacaccaaacggtctggtt
gtccccgtagtaaaagatgtcataaacaaagggatctatgatctgtcgcgtgaactcgga
gaaatttcgaaaaaagcgcgtgccggtaaattaaccaccagagatatgcagggtggcagt
atgactatctccagtcttggtggtattggcggtacacagtttacccctatcgtaaatgcg
cctgaagttgctattttaggtgtttctaaatcggcaatgaaaccattatggaacggtaaa
gagtttgagcctcgtctgatggttccacttgcactttcctatgatcaccgtgtcatcgat
ggtgcagagggtgctcgcttcatcactgcgattaataattacttgtctgacttacggaca
ttaatcttataa

DBGET integrated database retrieval system