KEGG   Psychromonas ingrahamii: Ping_2959Help
Entry
Ping_2959         CDS       T00450                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pin  Psychromonas ingrahamii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ping_2959
Enzymes [BR:pin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ping_2959
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Ping_2959
Lipid biosynthesis proteins [BR:pin01004]
 Fatty acid synthase
  Component type
   Ping_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3648795..3649403
Genome map
AA seq 202 aa AA seqDB search
MTKILSFYFALLFCAAANGQTLLILGDSLSAGYNMSIEQSWPSLLSAELQALDKSTTVVN
ASISGDTTDNALARLPELLSLHQPSSVLIELGANDGLRGFPPALVMGNLKKMINLIKAQN
GSPILMQIQVPPNYGKRYSEAFSSLYPQLSEKYNTPLIPFFLEQVIVKPQWMMNDGLHPT
AEAQPWIAQYMAKQLAPYLKNR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatactttccttttattttgctctgcttttttgtgcagcagctaacggtcaa
acactgcttattctgggtgacagtttaagtgccggttataatatgtccatcgagcagagt
tggccttctttgttaagtgcagaattgcaggcactggataaatcaaccacggttgttaat
gcaagtatttctggcgatacaacagataatgccttagcccgcttgcctgaattactgtcg
ttacatcaacccagctccgtattaattgaactgggtgcaaatgatggcttacgtggtttc
ccccccgcattggtgatggggaatcttaaaaagatgattaacttaattaaagctcaaaat
ggctctcccatcttgatgcaaatccaagttccgcctaactacggtaaacgttacagcgaa
gcatttagttcactttacccacaattaagtgaaaaatacaatacgccgttaatcccgttt
tttctggaacaggtaatagtcaagccacaatggatgatgaatgacggcttgcacccgacc
gcagaagctcaaccctggatagcacaatatatggctaaacaactggcaccttatttgaag
aacagatag

DBGET integrated database retrieval system