KEGG   Psychromonas ingrahamii: Ping_3231Help
Entry
Ping_3231         CDS       T00450                                 

Definition
putative DNA polymerase III, psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pin  Psychromonas ingrahamii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pin00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pin00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pin03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pin03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3985186..3985581)
Genome map
AA seq 131 aa AA seqDB search
MKHQQALYLQEMGITRWQVRKPDLFPLSLNLCTIDLSHYKLLLVASTADFAHPLMPSILN
AFNLKLSEVYCCSTDQFENLQGQLPELIWSTLGEINQPHGHKLLTSSTLVQLAADANAKK
ALWKQFCAFNQ
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaacaagcgctttatttacaggagatggggataacccgttggcaagtccgt
aaacctgatttgttccctctttctctaaatttatgcactattgatttaagtcattataaa
ttgttgctggtggcctcgacagccgactttgcacaccctcttatgcccagcatactcaat
gcctttaatttaaaattaagcgaagtatactgctgctcaacggatcaatttgaaaacctg
cagggacagttacccgaacttatctggtcaactctgggtgaaattaatcaaccccatggt
cataagttattaacatcatcaacccttgtacagttggctgctgacgcaaatgcaaaaaag
gcattatggaaacagttttgtgcttttaatcaataa

DBGET integrated database retrieval system