KEGG   Psychromonas ingrahamii: Ping_3231Help
Entry
Ping_3231         CDS       T00450                                 

Definition
putative DNA polymerase III, psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pin  Psychromonas ingrahamii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ping_3231
   00240 Pyrimidine metabolism
    Ping_3231
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ping_3231
   03430 Mismatch repair
    Ping_3231
   03440 Homologous recombination
    Ping_3231
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Ping_3231
DNA replication proteins [BR:pin03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Ping_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3985186..3985581)
Genome map
AA seq 131 aa AA seqDB search
MKHQQALYLQEMGITRWQVRKPDLFPLSLNLCTIDLSHYKLLLVASTADFAHPLMPSILN
AFNLKLSEVYCCSTDQFENLQGQLPELIWSTLGEINQPHGHKLLTSSTLVQLAADANAKK
ALWKQFCAFNQ
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcaacaagcgctttatttacaggagatggggataacccgttggcaagtccgt
aaacctgatttgttccctctttctctaaatttatgcactattgatttaagtcattataaa
ttgttgctggtggcctcgacagccgactttgcacaccctcttatgcccagcatactcaat
gcctttaatttaaaattaagcgaagtatactgctgctcaacggatcaatttgaaaacctg
cagggacagttacccgaacttatctggtcaactctgggtgaaattaatcaaccccatggt
cataagttattaacatcatcaacccttgtacagttggctgctgacgcaaatgcaaaaaag
gcattatggaaacagttttgtgcttttaatcaataa

DBGET integrated database retrieval system