KEGG   Psychromonas ingrahamii: Ping_3232Help
Entry
Ping_3232         CDS       T00450                                 

Definition
FAD dependent oxidoreductase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ping_3232
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     Ping_3232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3986650..3988263)
Genome map
AA seq 537 aa AA seqDB search
MSLNRINNIKQLAEDELDVLILGGGINGAVAAASLAAKGAKVGLIDKGDFAGATSSNSSN
LAWGGIKYLESHEYLLVNKLCKSRNNLMRHYPSSVTEVRFLTTIQKGFRFPVWFVFMGTL
AYWLFGRLFTMAPKYLTRNAIKKLEPSIKTEGAQAGFEYSDAFLKDNDSRFVFNFITAAA
KKSAAVANYVESVNAVRENGLWVIQAKDTTNNKIFTIKAKTLINACGPLVDQVNKGSEQK
TSHHHLFSKGVHLTVDRISKEHRVLAFFASDGRLFFVLPMGNKTCIGTTDNQVESHQTSV
TDEDRQFILDNANALLELDKPLTKADIIAERCGVRPLAIEAEEGVADWVALSRKHAIDVN
KADKHISIFGGKLTDCINVGEEIAEIVKSLSIPLPKSESIWYGEPADSVKAKFMSAIEEF
NIDKLTPKGAIEPLSGRFWRRYGEDAFILLEAIKQNPEKANLALEHTEFTWAEIDWVADH
EMIVNLDDLLRRRSKATLVIRKEYLDNAKGLEAVSERIFGENAQQKVAEFRSTANFN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcaatcgaataaacaatattaagcaactggctgaagatgagctagatgtactt
attttaggcggtggtatcaatggtgctgttgcagctgcatctttggctgctaaaggtgct
aaagttggccttattgataagggagattttgcaggagcaacgagctctaattcatcgaat
cttgcatggggtggtatcaaatacctggagagccatgaatatttattagttaataagctt
tgtaaaagccgtaacaaccttatgagacattatccgtcatcggttactgaggttcgtttc
ttaacaactattcaaaaaggttttcgttttcctgtctggtttgtgtttatggggactttg
gcttattggttatttggacgattatttacgatggcacctaagtatcttactcgaaatgct
atcaagaaattagagccaagcattaagacagagggcgcacaagcaggttttgaatattca
gatgcattcttaaaagataatgactcacgttttgtttttaattttataacggctgctgca
aaaaaatcggcggctgttgctaactatgtagaatcggtaaatgccgttcgtgaaaacgga
ctatgggtaatacaagcgaaagatactaccaataataaaatattcactattaaagcgaaa
acactgatcaatgcctgtggtcctttggttgaccaagttaataaagggtctgagcagaaa
acatcacatcatcatttattttctaagggtgttcatttaaccgttgatcgtatttcaaaa
gaacaccgtgtattggcattttttgccagtgatgggcgtttattctttgtcttacctatg
ggaaataaaacctgtattggcacaacagataatcaagttgagagtcatcaaacatcggta
accgacgaagatcgtcaatttattctcgataatgccaatgccttattagaattagataag
ccgctaaccaaagctgacattattgcagagcggtgtggtgtacgaccattagcgattgaa
gccgaagaaggtgttgctgattgggttgccttgtcacgtaagcatgcaatagatgttaat
aaagccgataaacacattagtatttttggtggtaagctgacggattgtattaacgtaggt
gaagaaattgcagagatagttaaaagtttatctattccactgccaaaatcagaatcaatc
tggtatggcgagccagctgactcagttaaagcaaaatttatgagcgctattgaagaattt
aatattgataaattgactccaaaaggagctattgagcctttatcgggtcgtttctggcgt
cgttatggtgaagatgcttttattctattggaagctattaagcagaaccctgaaaaggca
aatctagcacttgaacatacagagtttacttgggctgaaatcgattgggtagccgaccat
gaaatgattgttaacctcgatgatctattgcgtagacgttcaaaagcaacccttgttatt
cgtaaagaatatttagataatgcaaaaggactggaagctgtcagcgaacgtatttttggt
gaaaacgcgcagcaaaaagtcgccgagtttcgcagtacagccaacttcaattga

DBGET integrated database retrieval system