KEGG   Psychromonas ingrahamii: Ping_3290Help
Entry
Ping_3290         CDS       T00450                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ping_3290
Enzymes [BR:pin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ping_3290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4061419..4062513
Genome map
AA seq 364 aa AA seqDB search
MKKASQLRLLLPFLFLLSSALTSAENDMENNPYGLTTEAELSDTFNSKINAFWKKNAISV
SLQGVDNKRLHTISIKTGNANAIVISQGRNESVLKYKELAFDLNRQGYDLYLIDHRGQGF
SERLGGDQDHGHVVHFQDYVDDLNRYILSLDLANNYQHNYLLAHSMGGTISALYLEQYNH
PFQAAILLSPMMSINLGSIPSFIAKLLTFSGAEVCSWFSDQSCYVFGGKEYKPRAFIGND
LTSSEVRFNASQNTYIEFPETQLGDASMRWVAQSLSATGQVVDNANKINIPILLLQAGAD
QVVTAAGQNQFFKNITQCKAKQFLTIPNAKHEIYLEKDQSRLVALNAALEFLEASQQGTL
RCTK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcttctcaactaagattactgctaccttttttatttttactttctagcgca
ctgacctccgcggaaaatgacatggaaaataatccctacggtttaacaactgaagccgaa
ctgagtgatacttttaacagtaagataaatgcattttggaaaaaaaatgcaatctcagtt
tccttacaaggcgttgacaataaaagactgcatactattagtattaaaaccggtaatgct
aacgcgatagtgattagccagggtcgaaacgagagtgtcttaaaatacaaggaacttgcc
tttgatcttaaccgtcaaggttatgatctttatttaattgatcaccgaggtcaaggattt
tcagaacgcttaggcggagatcaagatcacgggcatgttgttcatttccaagattatgtc
gatgaccttaaccgttatattttatccttagacttagccaacaattaccagcataattac
ctgctagcacactcaatgggcggcacgataagcgcgctatacctcgaacaatataaccac
ccatttcaggcagccatattattaagccccatgatgtcaatcaatttaggcagcataccc
agttttattgccaagctattaaccttcagtggtgccgaagtgtgcagctggtttagcgat
caatcctgttatgtgttcggtggcaaagaatataagcccagagcatttatcggtaatgat
ttaacctccagcgaagtgcgttttaatgcatcacaaaatacctacatagagtttcctgaa
acacaacttggtgatgcgagtatgcgctgggttgcccaaagccttagcgccactgggcag
gtggtggataacgccaataaaataaatattccaattctattactgcaagcaggagccgat
caggttgtgacagcggcagggcaaaatcaattttttaaaaatattacccagtgtaaagcg
aaacaatttctcactatacccaatgcaaaacatgagatatatttagaaaaagatcaatcc
cgattagtggctttaaatgcagcacttgaatttttggaagcatcacaacaaggcacactg
cgatgtacaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system