KEGG   Psychromonas ingrahamii: Ping_3303Help
Entry
Ping_3303         CDS       T00450                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pin  Psychromonas ingrahamii
Brite
Enzymes [BR:pin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ping_3303
Secretion system [BR:pin02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Ping_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4074208..4074963)
Genome map
AA seq 251 aa AA seqDB search
MATIFSKTGVICVFLLSSFAAVSATSESPSSLVVEEITTKMESLKIPVNEINKSAVEGLY
EVISNGDIYYISEDATHLLYGSIYALDNQMVNITEQKKAQLSRQKVAKNIDKITAFEKDM
IVFKAQDEKHVVTVFTDPTCSYCQKLHSQMADYNKLGITIRYLAFPRAGIDSSTYHTMVS
IWCSNDPKNAMNMAKKRREIPSETCENTVKEQYQLGRLLGVNGTPALILENGTLTPGYLP
PQRLLQLLEEK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcgactattttttcaaaaacaggggttatttgtgtctttttattaagcagttttgca
gccgtctcagcgacgtctgaatctccctcctcgctggtggttgaggaaataacgactaaa
atggaaagccttaagatccccgttaatgagattaataagtcagcagtagagggattatat
gaagtgatctccaatggtgatatttattatattagtgaagatgcaacccatttgttgtat
ggaagtatttacgctttagacaatcagatggtcaatattactgagcagaaaaaagcacaa
ttaagtcgccaaaaagtcgctaaaaatatagacaaaataaccgcctttgaaaaagacatg
attgtgtttaaagcgcaggatgagaaacacgttgtcactgtttttaccgatcctacctgc
agttactgtcagaaattacattcacaaatggctgactataataaattgggtattactatt
cgctatttagcatttccgcgagcgggtattgattcttcaacctaccatactatggtctca
atatggtgctcaaacgatcctaaaaatgcgatgaatatggctaaaaaacgccgtgagatc
ccctctgaaacctgtgaaaacaccgtcaaggagcaatatcagcttgggcgtttacttggg
gttaatggcacaccggctttgattttagaaaatggtaccctcaccccgggttatcttcct
cctcagcgtttgctgcagttgttagaggaaaaataa

DBGET integrated database retrieval system