KEGG   Psychromonas ingrahamii: Ping_3315Help
Entry
Ping_3315         CDS       T00450                                 

Definition
(GenBank) acetaldehyde dehydrogenase / alcohol dehydrogenase AdhE
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00071  Fatty acid degradation
pin00350  Tyrosine metabolism
pin00620  Pyruvate metabolism
pin00625  Chloroalkane and chloroalkene degradation
pin00626  Naphthalene degradation
pin00650  Butanoate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_3315
   00620 Pyruvate metabolism
    Ping_3315
   00650 Butanoate metabolism
    Ping_3315
  Lipid metabolism
   00071 Fatty acid degradation
    Ping_3315
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ping_3315
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ping_3315
   00626 Naphthalene degradation
    Ping_3315
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ping_3315
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ping_3315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABM05002
JGI: Ping3315
UniProt: A1SZT7
Position
4088948..4091620
Genome map
AA seq 890 aa AA seqDB search
MTVSTVADLEALIARVKVAQAEYATFSQEKVDEIFRVAALKVSTHRIELAKMAVKETGMG
IMEDKVIKNHFASEFIYNSYAHTKTVGELSRNESLNTVTLAEPMGIICAIIPTTNPTSTA
IFKTLMALKTGNGCIVAPHPRAKECTNYAAKIVLDAAVSAGAPKDIIGWIDIPSIELTNA
IMKHKDTAIILATGGPGMVKAAYSSGNPAIGVGAGNTPVIIDESADIKRAVSSILMSKTF
DNGMICASEQAVIVVESKYNEFRVRLQEYGAFILNAVDAEKVAKTMFIDGALNAKIVGQS
AYTIAKLAGVKVPTSTKILVGEGPQVVVENMFAHEKLSPTLGLFKATNYEDAVRQAKIVL
EIGGVGHTAALYTDQDANSDCIDKFGLTMKACRIVINSPTSHGGIGDIYNFGFAPSMTLG
CGTHSGNAVSENVGPQHLINTKKIAKRAENMLWHKLPKSIYFRRGCLPIALTDLEDKKRA
MIVTDGFLFANGYVDELRSILESKGMLVEIFHEVEADPTLAIIKKGAAACNVFNPDVILA
VGGGSPMDAAKIMWVLYEHPSTDFEDLSMRFMDIRKRIYKFPKMGVKADLVCITTTSGTG
AEVTPFAVITDEKTGKKYPLADYELTPSMAIVDANLVMDMPKSLCAFGGYDAVTHAMEAY
VSILANEYSDGQALQALKLLKEYLPSSYHNGKNDAVAREKVHNAATIAGMAFAQSFLGVC
HSMAHQIGNEFHIPHGLANALLMTNTIRFNATNNPTKQGTFSQYDRPKARARYAEIADHL
GFREGNTEAKIKALLTWLDELKVELNIPLSIQDAGVKEDDFLAAVDALAEQAFDDQCTPA
NPRYPLVSELKAVLLASYYGTDYVDVMDAPEVEIVEMPKLVKEEKVKKEA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgacagttagcactgttgctgatctggaagcgctgattgcacgcgtcaaagtagcacaa
gcagagtatgcaaccttctcacaggaaaaggttgatgaaatattccgtgtcgcagccctt
aaagtttcaacacaccgtattgaacttgcaaaaatggccgttaaagaaacaggcatgggg
atcatggaagataaagtcattaaaaaccactttgcctctgagtttatttataacagctac
gcacacacaaaaaccgtaggtgaattatcacgcaatgaatctctcaatacggtgacactt
gccgaaccgatgggcattatctgtgcgatcattccaacaactaacccgacatcaacggct
atttttaaaacgttaatggcgcttaaaacaggtaatggttgtattgtcgcgccgcatcca
cgtgctaaagaatgtacaaactacgccgctaaaatcgttttagacgctgctgtttctgcc
ggcgcgccaaaagatattatcggttggattgatattccatctattgaactgactaatgcg
attatgaaacacaaagatactgccattatccttgcgaccggtggcccgggcatggttaaa
gccgcatactcttcaggtaatcctgcaattggtgttggcgcgggtaatacgcccgtcatt
attgatgaatcagctgatatcaaacgcgcggtctcttcaatcttaatgtcaaaaacattc
gataacggtatgatctgtgcgtccgagcaggctgtgattgttgttgaatcaaaatataac
gaatttagagtgcgccttcaagaatacggcgcttttatactgaatgcagttgatgccgaa
aaagtagctaaaacgatgtttatcgacggcgcgcttaacgctaaaattgtaggtcaatca
gcctatactattgctaaacttgcaggcgttaaagtccccacttcaactaaaattcttgtg
ggtgaaggccctcaagtcgtcgttgaaaacatgtttgcacatgaaaaactatctccaacg
ctaggtctatttaaagctacaaattatgaagatgcggtccgtcaagctaaaatcgttcta
gagataggtggtgttggtcacacagccgcactatacacagaccaggatgcaaactcggat
tgtattgataaatttggccttaccatgaaagcctgtcgtattgtgattaactcaccaaca
tcgcacggtggtatcggtgatatttataactttggttttgcaccttcaatgaccttaggt
tgtggtacgcacagtggtaatgcagtgtcagaaaatgtaggtccgcaacatctaatcaat
actaaaaaaattgcgaagagagctgaaaatatgttgtggcataaactaccaaaatctatc
tacttccgtcgtggttgtttacctatcgcactgactgatttagaagataaaaaacgtgca
atgatagtaacggatggttttctatttgctaacggttacgtggatgagttacgttcaatc
cttgaaagtaaagggatgttagttgaaatcttccacgaagttgaagcagatccaaccctt
gccattatcaaaaaaggggcggctgcttgtaatgtctttaatccagacgttattcttgct
gtcggtggtggttcacccatggatgcagcgaaaatcatgtgggttctatatgagcacccg
tcaactgattttgaagacttatcaatgcgctttatggatatacgtaaacgtatctacaaa
ttccctaaaatgggtgttaaagcggatctcgtctgtattacaacgacttctggtaccggt
gctgaagtcaccccttttgccgttataaccgatgaaaaaaccggtaaaaaatacccatta
gccgattatgaactaacccccagtatggcaattgttgatgcaaatctagtaatggacatg
ccgaaatctctctgtgcattcggtggttacgatgcagtaacacatgcgatggaagcttat
gtttcaatacttgctaacgagtactcagatggtcaagcactacaagcgcttaaactatta
aaagagtacctgccaagctcttaccataacggtaaaaatgatgcagtggcgcgtgaaaaa
gtacataacgcagccactatcgcgggcatggcgtttgctcaatcattcctgggagtgtgt
cactctatggcgcatcaaattggtaatgaattccatattccacacggtttagcaaatgca
ttgttaatgaccaatactattcgttttaatgcaacgaataacccaactaaacaaggcacg
ttctcacaatacgaccgtcctaaagcacgtgctcgttacgcagaaattgctgaccattta
ggtttccgtgaaggtaacactgaagctaagattaaggcactgctaacttggttagatgag
ttaaaagttgagttaaatattcccctttcaatccaagacgcgggggttaaagaagatgac
ttcctggcggcagttgatgcgctagcagaacaagcctttgatgaccaatgtactccggct
aacccgcgttaccctcttgtatctgagcttaaagcggtactgcttgcttcttactacggc
acagattacgttgatgtaatggatgcacctgaagttgaaatagttgaaatgcctaaatta
gtaaaagaagaaaaagtaaaaaaagaagcttaa

DBGET integrated database retrieval system