KEGG   Psychromonas ingrahamii: Ping_3422Help
Entry
Ping_3422         CDS       T00450                                 

Definition
(GenBank) LSU ribosomal protein L9P
  KO
K02939  large subunit ribosomal protein L9
Organism
pin  Psychromonas ingrahamii
Pathway
pin03010  Ribosome
Module
pin_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pin00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Ping_3422
Ribosome [BR:pin03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ping_3422
  Bacteria
    Ping_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_N Ribosomal_L9_C DUF1118
Motif
Other DBs
NCBI-ProteinID: ABM05106
JGI: Ping3422
UniProt: A1T041
Position
4227100..4227552
Genome map
AA seq 150 aa AA seqDB search
MEIILQDTVANLGKLGDKVVVKSGYARNFLFPQQKAVPANKANLEAFETRRVELEAKQAA
NLAAAEKRGAALAALEAVVIASKAGDVGKLFGSIGTRDIATAITAAGVPVVKSEVRLPEG
ALRNTGLFEIAVVVHSEVSTIVKIEVVQAE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaaattatcctacaagatacagttgctaaccttggtaaacttggcgataaagttgtt
gttaaatcaggttacgcacgtaactttctttttccacaacaaaaagctgttccagcaaac
aaagcaaacttagaagcttttgaaacacgtcgtgttgaattagaagctaagcaagctgct
aaccttgctgctgcagaaaaacgtggcgctgcattagctgcattagaagcggttgttatc
gcatctaaagccggcgatgttggtaaactattcggttcaatcggtacgcgtgatattgct
actgcaatcactgctgctggtgtacctgttgttaaaagtgaagttcgtcttcctgaaggc
gctttacgcaacactggtttattcgaaattgctgtagtagtacactctgaagtgtctact
attgttaaaattgaagttgttcaagctgaataa

DBGET integrated database retrieval system