KEGG   Psychromonas ingrahamii: Ping_3422Help
Entry
Ping_3422         CDS       T00450                                 

Definition
50S ribosomal protein L9
Orthology
K02939  
large subunit ribosomal protein L9
Organism
pin  Psychromonas ingrahamii
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pin00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Ping_3422
Ribosome [BR:pin03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    Ping_3422
  Bacteria
    Ping_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4227100..4227552
Genome map
AA seq 150 aa AA seqDB search
MEIILQDTVANLGKLGDKVVVKSGYARNFLFPQQKAVPANKANLEAFETRRVELEAKQAA
NLAAAEKRGAALAALEAVVIASKAGDVGKLFGSIGTRDIATAITAAGVPVVKSEVRLPEG
ALRNTGLFEIAVVVHSEVSTIVKIEVVQAE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaaattatcctacaagatacagttgctaaccttggtaaacttggcgataaagttgtt
gttaaatcaggttacgcacgtaactttctttttccacaacaaaaagctgttccagcaaac
aaagcaaacttagaagcttttgaaacacgtcgtgttgaattagaagctaagcaagctgct
aaccttgctgctgcagaaaaacgtggcgctgcattagctgcattagaagcggttgttatc
gcatctaaagccggcgatgttggtaaactattcggttcaatcggtacgcgtgatattgct
actgcaatcactgctgctggtgtacctgttgttaaaagtgaagttcgtcttcctgaaggc
gctttacgcaacactggtttattcgaaattgctgtagtagtacactctgaagtgtctact
attgttaaaattgaagttgttcaagctgaataa

DBGET integrated database retrieval system