KEGG   Psychromonas ingrahamii: Ping_3493Help
Entry
Ping_3493         CDS       T00450                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pin  Psychromonas ingrahamii
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ping_3493
   00565 Ether lipid metabolism
    Ping_3493
   00590 Arachidonic acid metabolism
    Ping_3493
   00591 Linoleic acid metabolism
    Ping_3493
   00592 alpha-Linolenic acid metabolism
    Ping_3493
Enzymes [BR:pin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Ping_3493
    3.1.1.32  phospholipase A1
     Ping_3493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4323494..4324351
Genome map
AA seq 285 aa AA seqDB search
MYLLFLVFVLLFSAATRAEESAVDQRIEQENKLQKDRFSIIPYKPNYLLPFTFNNNIQSY
DADKGVAASDRLQPVEIKFQLSFKTPVLVDIADLPLTLYFGYTQVSFWQAYNSGNSSPFR
ETNYEPEMFLRWVHDTKLGGDWHFKLATLNLAHQSNGKTEPGSRSWNRIESNIVLENGNI
TLAFNPWFRLPEDAKNDNNPDLLDYYGHGKIYALYQINKHNFSITSRNNIESGFSKGSLE
LNWSVPLHGSIRGYFQVFSGYGNSLIEYNQYTNTVGLGISLTDWL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtatctattatttttagtttttgttttgttatttagcgcggccacacgggcagaagaa
tctgccgttgatcagcgtatcgagcaggagaacaaactccagaaggaccgcttttctatt
atcccctataaacccaattaccttttgccttttacttttaataataatattcaatcttac
gatgctgataagggtgttgccgcatcggaccgattacaacccgttgagataaaatttcaa
cttagttttaaaacacctgtcttagtggatattgccgacttacccctcacgctttatttt
ggttatacccaagtctctttctggcaggcttataatagcggtaattcatccccgtttcgc
gaaactaattatgaaccggagatgtttctacggtgggtacatgacacaaaactaggagga
gattggcattttaaattagcaacactgaacttagcccatcaatccaatgggaaaacagag
ccgggatcccgcagctggaatcgtatcgaaagcaatattgtcttggaaaatgggaatatc
actctggcgtttaatccctggtttcgtttaccagaagatgcaaaaaatgataataatcca
gatttattggattattatggccacggaaaaatttatgctctttatcaaataaataagcat
aacttttcaattaccagccgcaataatattgaaagtggctttagcaaagggtcactggag
ctcaattggagtgtccctcttcacggtagtattcgcggttattttcaggttttctcaggc
tatggcaacagcctgatagagtataatcaatataccaatacagtagggttaggtatctca
ttaaccgactggttatag

DBGET integrated database retrieval system