KEGG   Psychromonas ingrahamii: Ping_3600Help
Entry
Ping_3600         CDS       T00450                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00620  Pyruvate metabolism
pin00640  Propanoate metabolism
pin00680  Methane metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_3600
   00620 Pyruvate metabolism
    Ping_3600
   00640 Propanoate metabolism
    Ping_3600
  Energy metabolism
   00680 Methane metabolism
    Ping_3600
Enzymes [BR:pin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ping_3600
Lipid biosynthesis proteins [BR:pin01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ping_3600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABM05283
JGI: Ping3600
UniProt: A1T0L8
Position
4413794..4415548
Genome map
AA seq 584 aa AA seqDB search
MSFSEIKKDPLSASEHNLINYQDTYTHFNWQQAQQRIAGNKDGLNIAYEALDRHVDEGFG
EQIAIRWLSKQGLAVDISYTELMEQTSRFANILLKFGVKPNDTVFGLCSRVPQLYISLLG
TLKFGAVFSPLFSAFGPEPIRSRMEIGQARVLITSEALYLKKVNPWREQLSSLKWVLLYN
VTGPLPDNCYDLDALLEESSADFPARLCDPEQLALLHFTSGTTGKPKGAMHVHQAVVYHS
ISAFYALDLKPGDRYWCTADPGWVTGTSYGIIAPLCNRVTMIIDEAEFDAEHWYQLLSEQ
KINVWYTAPTAIRMLMKAGGELATQYDLSALRFIASVGEPLNPEAVVWGQKVFAMPFHDN
WWQTETGGIMIANLATNAVRPGSMGRPLPGIEVAIMEHTEGGEIKATTKANQVGELALKK
GWPSMFRGYLHEEQRYQKCFVGDWYLTGDLAMCDADGYYWFVGRADDVIKSSGHLIGPFE
VESVLMEHPAVAEVGVIGLPDEVAGEIVKAFVALKPGYEGDEILRKTLLGHSRKRLGAAV
APREIVFRKNLPKTRSGKIMRRLLKARELGLPEGDISTLESDEA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttctgaaataaaaaaagatcctttatcggcatctgagcataacttaattaat
taccaagatacttatactcactttaactggcaacaggcccagcagcgtattgccggcaat
aaagatgggttaaatatcgcctatgaagcactggatcgtcatgtcgatgaggggtttggc
gaacagatagccattcgctggctaagcaaacagggtttggctgtagacattagttatacg
gaattaatggagcaaaccagtcgttttgccaatattctgctcaaatttggtgtgaagcct
aatgatactgtgttcggtttatgcagcagagtaccgcaactctatatctcattattgggc
acgcttaaatttggcgcggtattttcccccttattttcagcatttggtcccgagcctatt
cgttcacgcatggagataggccaagcacgcgttttaattaccagtgaagcactttatctg
aaaaaagttaacccctggcgcgaacagttaagcagcctaaaatgggtgttattgtataat
gtaaccggccctctccctgataattgttatgatcttgatgctttattagaagaaagtagc
gcggacttccctgcccgtctctgcgatccggaacaactcgctttattgcactttacctcg
ggcacaacgggtaaacctaaaggcgctatgcatgttcatcaagccgtcgtttaccatagt
atttccgctttttacgcactggatcttaaacccggagaccgttattggtgtaccgccgat
ccgggttgggtaaccggcacttcctacggcattattgccccgttatgtaatcgagtcact
atgatcattgatgaagctgaatttgatgctgagcattggtatcagttactcagcgaacaa
aaaattaatgtctggtataccgctccgaccgctattcgtatgttaatgaaagctggaggt
gagttggccactcaatatgatcttagtgccttacgttttattgccagtgtaggtgagccc
cttaatcctgaagctgtcgtctggggacagaaagtttttgccatgccgtttcacgataac
tggtggcagaccgaaactggcggcatcatgatcgccaaccttgcaacgaatgccgttcgc
ccaggttcaatgggcaggcccttacccggtattgaggttgccattatggagcatactgaa
gggggggaaatcaaagccactacaaaagcaaatcaagtcggtgagctggcactgaaaaaa
ggttggccatctatgtttcgtggttatctgcatgaagagcagcgttatcaaaaatgtttt
gttggtgattggtatttaaccggcgacctcgcgatgtgtgatgccgatggttattactgg
tttgtgggtcgggcagatgatgtgattaaaagctcgggacatttgattggtccttttgaa
gtagaaagtgtgttaatggagcaccccgctgtcgccgaggttggagtgataggtttaccc
gatgaagtcgcaggtgaaatcgtaaaagcttttgtggcccttaaacccgggtatgaaggt
gatgaaatattacgtaaaacgttattaggtcattcacgtaaacgtttgggcgccgccgtt
gcaccaagagagattgttttccgtaaaaatttacccaagacccgcagtggcaaaattatg
cgccgtttattaaaagcgcgcgaactcggattgccggaaggtgatatttccactcttgaa
agtgatgaagcctaa

DBGET integrated database retrieval system