KEGG   Psychromonas ingrahamii: Ping_3641Help
Entry
Ping_3641         CDS       T00450                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pin  Psychromonas ingrahamii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pin00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4455661..4456395)
Genome map
AA seq 244 aa AA seqDB search
MKEARLLVTRFAPHAQRLVNLLNAQGTVAFAQPLLALQKTTEFNHASKVLAKNYDYIIAV
SPNAVDYTQKALAGINWPQTEYLAVGLATQAKLKAATTQNVVVPEKCFDSEGLLDLPLLL
NLQGKHILILRGVGGRELLCDTLRQRGAIVDYYQPYQRVAIVLCGKALIKEWQQQNINGA
IISSIELLERLMSVVPLAAHEWLKELTIYAPSERILDQAKRWGWSNTKVLPGMSDQQVID
YFKH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcgcgcttattagtgacacgttttgcacctcatgcacaacgcttagtgaat
ttactcaatgcgcaggggacggttgcctttgcgcaacccttattggcacttcagaaaaca
acagaatttaaccatgcaagtaaagtgttggcaaaaaattatgattatattatcgcggta
agtcccaatgcggttgactatacccagaaggctctggcgggtatcaactggccgcagact
gaatatttagctgttggattagcgactcaggctaagctaaaagcagcaaccacgcagaat
gtcgttgtgcctgaaaaatgctttgatagtgaagggttacttgatttacccttattactg
aatttacagggtaagcatatccttattttacgcggagtcggcggccgtgagttactctgt
gacaccttaagacaacgcggggcaatcgttgattattatcagccttatcaacgtgttgct
attgtactgtgtgggaaagctttaataaaagaatggcaacaacaaaatattaatggtgct
attatcagtagtattgaattgctggaaagattaatgtctgttgtgccgcttgccgcgcat
gaatggttgaaggagcttactatttatgccccaagtgagcgtatactcgatcaggcaaag
cgttggggctggtcaaatacaaaagtacttcccggaatgtctgatcagcaagtgattgat
tattttaaacattag

DBGET integrated database retrieval system