KEGG   Psychromonas ingrahamii: Ping_3721Help
Entry
Ping_3721         CDS       T00450                                 

Definition
CheB-type protein glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pin  Psychromonas ingrahamii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pin00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ping_3721
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ping_3721
Enzymes [BR:pin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ping_3721
Two-component system [BR:pin02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ping_3721
Bacterial motility proteins [BR:pin02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ping_3721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4536594..4537181
Genome map
AA seq 195 aa AA seqDB search
MKAVNRSYDLVIIGGSAGAIQALPLILAQLPESFSLPIVIVLHRLEGSGSYLHQYFKQYC
VLPVVEVEDKQPLLPGQVYIAPAGYHLLVENEGHFSLSIDPRVNYCRPSIDVLLESAADS
YANRLVGIILTGANTDGSKGLKQVKEAGGLTIVQRPTTAAVDIMPRAAIKATDVDWILDL
EEIGFLLAEIQYSDD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgttaaccgtagttatgatctggtgatcattggcggttcagcaggtgctata
caggcgctaccgcttatacttgcgcagctgccggagtccttttccttgccgatcgttatc
gtgctgcaccgtctggagggctccggcagctatctgcatcagtatttcaagcagtattgt
gttttacctgtggttgaggtcgaggataagcaaccattattacccggtcaggtttacatt
gcacctgcgggttaccatctgctggttgaaaatgagggacactttagtttatcaattgat
ccacgggtcaattattgtcgtccctcaattgatgtcctgctagaaagcgcggcagatagt
tatgcgaatcggctggtcgggatcattctgaccggggcgaataccgatggcagcaaaggg
cttaagcaagttaaggaagcagggggactgacaattgttcagcgacctacaacggcggca
gtagatattatgccaagagcagcgatcaaagcaacggacgtcgattggatactggatctg
gaagaaatcggtttcctgctggcagagattcagtacagcgatgattaa

DBGET integrated database retrieval system