KEGG   Pyrobaculum islandicum: Pisl_0042Help
Entry
Pisl_0042         CDS       T00444                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pis  Pyrobaculum islandicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pisl_0042
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pisl_0042
Exosome [BR:pis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pisl_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37219..38229
Genome map
AA seq 336 aa AA seqDB search
MKFPTVRPRRLRTNKIIRDAVAETALDPSDFIYPIFVKEGPGREAIPTMPGQHRWPVGEE
LIKHVEEALALGVNKFILFGVVPEEQKDPHGSRGYDPEGPVPKALRLLKETFGDKILLFA
DVCLCEYTDHGHCGVVKTTGGRWHIDNDETIKLYAKEALVYADAGADFVAPSGMMDGQVA
EIRKALDAHGFHHVGIMAYSAKYASAFYGPFRTAAASAPKFGDRRTYQMDPRNAHEALKE
VAMDLEEGADIVMVKPALAYLDVIRLVKQHYPWAPLAAYNVSGEYAMVKAAAAAGYIDER
VVTLEILTAIKRAGADLILTYHAPEAAKWLKDGTPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcccaactgtcagaccccgccgcctcaggacaaacaaaatcattagagacgcc
gttgccgaaactgccctcgaccccagcgacttcatctaccccatcttcgtcaaggagggc
cccggccgagaggccatacccaccatgcccggccaacaccggtggcccgtcggcgaggag
ctaattaaacacgtagaggaggccctcgccctaggagtcaacaagttcatcctattcggc
gtggtgccagaggagcagaaagacccccacggctccaggggctacgacccagagggcccc
gtccccaaggccctccgcctcctaaaagagaccttcggcgacaagatactcctcttcgca
gacgtctgcctctgcgaatacacagaccacggacactgcggcgtggtaaagaccaccggc
ggcaggtggcacattgacaacgacgaaactataaagctatacgccaaggaggccctcgtg
tacgcagacgccggcgctgacttcgtcgccccaagcggcatgatggacggccaagtggcc
gagatcagaaaagccctagacgcccacggcttccaccacgtgggcatcatggcatacagc
gccaaatacgcctcagccttctacggccccttccgcacagccgccgcctcagcccccaaa
ttcggcgacaggaggacataccagatggaccccagaaacgcccacgaagccctcaaagaa
gtcgccatggatctggaggagggcgcagacatagtcatggtaaagccagccctcgcatac
ctagacgtaatccgcctagtaaaacagcactacccctgggcccccctagccgcctacaac
gtctccggagaatacgccatggtaaaagccgccgcagccgccggatatatagacgagagg
gtcgtcacactagaaatcctaaccgcaataaaaagagcaggcgcagacctaatcctcacc
taccacgccccagaagccgcaaaatggctaaaagacggcaccccattctag

DBGET integrated database retrieval system