KEGG   Pyrobaculum islandicum: Pisl_0116Help
Entry
Pisl_0116         CDS       T00444                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pis  Pyrobaculum islandicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pis00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
109995..110642
Genome map
AA seq 215 aa AA seqDB search
MGGGTEIVVVRIKEGRCPSGAYCISIGRIIPRPDVVIPDGDYLVIMSPSVAYSINLSNVV
KKFKCVICVGPSTAEAVGNCIVPREYTSYGVARLLKELAPGRVVVLRSSAGNEVLKTLVP
NVIEVPVYDIVLDRDRIEEAAKAIVMAKAVVFTSSTAVEAVAKAVDLTGKTVVAIGAVTS
QKLTQLGIPHITAGEATIEEAVKTAKKELELFKPK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcggcacggagattgttgtagttagaattaaagagggacgttgccccagcggc
gcatactgtatatctataggtaggataattccacgccctgatgttgttattccagacggc
gactacttagtcatcatgagcccctctgtggcttattcgataaatttaagcaacgttgta
aagaagttcaaatgtgttatatgtgtaggcccttctacagcagaggccgtcggcaactgt
atagtgccaagagagtatacgagctatggcgtagcgcggttattgaaggagctcgcccct
ggcagagtcgtcgtcttgaggtcaagcgctggcaacgaggtgttaaagacgttggtgcca
aatgtgatagaagttcctgtctacgacattgtattagatagagacaggatagaggaggcg
gcaaaagccatagtcatggcaaaagctgtggtatttacaagctcaaccgccgtagaggcg
gtagctaaagctgtagacctcacaggaaagaccgtagttgcaatcggcgccgtgacgtca
caaaaattgacgcaactgggaataccacatataacggcgggtgaagctacaatagaggag
gctgtaaaaacggcgaaaaaagagttagaattatttaagcccaagtag

DBGET integrated database retrieval system